KEGG   Dickeya zeae: Dd1591_4079Help
Entry
Dd1591_4079       CDS       T00930                                 

Definition
Cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dze  Dickeya zeae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dd1591_4079
Enzymes [BR:dze01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Dd1591_4079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4603248..4604246)
Genome map
AA seq 332 aa AA seqDB search
MLKLMWRGWILMLMVWFSVSATAATGWETYKSRFMTADGRIQDTGNKNVSHTEGQGFAML
MAVHYDDRAAFDNLWNWTQSHLKNTVNGLFYWRYDPAASNPVADRNNASDGDVLIAWALL
KAGNKWQDNRYLQASDGIQKAIISNEIIQFAGRTVMLPGAYGFNKNSYVVLNPSYFLFPA
WRDFANRSHLQVWRQLIDDSLSLVGEMRFGQTGLPTDWVALNADGSMAPATAWPSRFSYD
AIRIPLYLYWYDAKTMALVPFQLYWRNYPRLATPAWVDVLSNNTAPYSMQGGLLAVRDLT
MGSFGALSDQPGAAEDYYSSSLRLLVALARGQ
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgctaaagctaatgtggcgtggttggatattgatgctgatggtgtggtttagtgtgtcg
gcgacggcggcgaccggctgggaaacctataaaagccgcttcatgaccgcagacggacgc
attcaggataccggcaataagaatgtcagccataccgaaggccagggtttcgccatgctg
atggcggtacattacgatgaccgtgcggcgttcgataacctgtggaactggacgcagagc
cacctgaaaaataccgtcaacggcttgttttactggcgttatgacccggcggcatccaac
ccggtagccgatcggaacaacgcatcggacggcgatgtgctgattgcctgggcgttgctg
aaggccggtaacaagtggcaggacaaccgctatttgcaggcttccgacggcatccagaaa
gcgatcatcagcaacgagattattcagttcgccgggcgcaccgtgatgttgccgggcgcg
tatggcttcaacaagaacagctatgtcgtccttaacccgtcgtatttcttgttccccgcc
tggcgcgactttgccaatcgcagccaccttcaggtctggcggcaactgattgacgatagc
ttatcgttggttggagaaatgcgtttcgggcagacgggattgccgacggattgggtggcg
ttaaacgccgatggcagtatggcgccggcaaccgcctggccgtcgcgtttcagttatgat
gctatccgtattccgttgtacctgtactggtatgacgccaaaacgatggcgctggtgccg
ttccaactgtattggcggaattatccccgtttggcgacgccggcctgggtcgatgtactg
agcaataacaccgcgccttacagtatgcaaggcggtttactggcggtgcgtgacctgacg
atgggcagtttcggcgcgcttagcgatcagcctggcgcggcggaggattattactcgtcc
agcttgcgtttgctggttgccctggcgcgcggccagtaa

DBGET integrated database retrieval system