KEGG   Dickeya chrysanthemi: Dd1591_4171Help
Entry
Dd1591_4171       CDS       T00930                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
dze  Dickeya chrysanthemi
Pathway
dze00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dd1591_4171
Enzymes [BR:dze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Dd1591_4171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase Aldolase Thr_dehydrat_C Herpes_UL16
Motif
Other DBs
NCBI-ProteinID: ACT08967
JGI: Dd1591_4171
UniProt: C6CQV0
Position
complement(4712498..4713430)
Genome map
AA seq 310 aa AA seqDB search
MVMKSGKLVVLGSINADHILNLAQFPRPGETVIGKQYGVAFGGKGANQAVAAGRSGADIE
FIACVGADDIGERIRQQLIKDRIDVSAVEAIPGQTTGVALIFVNGEAENMIAIHAGANAA
VTPDYLNRYQQKIVAASALLMQLESPLETVAAAARLAHDSGTKVILNPAPACPLPDELLS
LVDMITPNETEAQILTGVTVETEEDAQRAAQVLHDKGISTVLITLGSRGVWLSEQGNGRR
IAGFRVKAVDTIAAGDTFNGALVTALLESRPMDAAVKFAHAAAAIAVTRHGAQPSVPWRE
EIDAFLNAQE
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggtaatgaaatcaggcaagctggtagtcttgggaagtatcaacgcggatcatattttg
aatctggcgcagtttccccgtccgggcgaaacggtgatcggtaaacagtatggcgtggca
ttcggcggcaaaggcgccaaccaggcggtagctgccggacgtagcggcgctgatatcgag
tttatcgcttgtgtcggggcggacgatatcggcgagcgtattcgccagcaactgattaaa
gaccgtattgatgtctccgctgtcgaggcgattccagggcagactaccggagtagcgctg
attttcgttaacggtgaagctgaaaatatgatcgctattcatgcgggagccaacgcagcc
gtcacgcctgattacctgaatcgctatcaacagaaaattgtagcggcatccgcattgttg
atgcagttggagtcgccgctggaaacagtggctgcggccgctcgtctggctcatgacagc
ggaacgaaagtgatcctgaatccggcgccggcttgcccgttacctgatgaattgttgtcg
ctggtggatatgatcaccccgaatgaaacagaagcgcagattctgaccggcgttaccgtc
gaaaccgaagaggatgcgcaacgtgccgcacaggtgctgcatgataaaggcatttcgacg
gtactgattactctgggtagccgcggtgtttggttaagcgagcagggtaatgggcggcgc
attgccggtttccgtgtcaaagcggttgataccattgccgccggcgatacattcaacggc
gcactggtgacggctcttttagagtctcgcccaatggatgccgcagttaaattcgctcat
gcagcggcggctatcgcagtaactcgccatggcgctcagccttccgttccctggcgtgaa
gagattgatgccttcctgaatgcacaggagtaa

DBGET integrated database retrieval system