KEGG   Durio zibethinus (durian): 111311698Help
Entry
111311698         CDS       T05242                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
dzi  Durio zibethinus (durian)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dzi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    111311698
   00500 Starch and sucrose metabolism
    111311698
Enzymes [BR:dzi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     111311698
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 575 aa AA seqDB search
MEVLKFFSLYLFVCCFYVISNLNNGVEASHKVYKELQSESAVNVKQLHRTGYHFQPPKNW
INDPNGVMHYNGIYHVFYQHNPKGAVWGNIIWAHSVSKDMVNWEALEPAICPSEHFDING
CWSGSATILPDNTPVLLYTGIDPQHNQVQNYAIPANLSDPYLRKWIKPADNPVAVADETM
NKTAFRDPSTAWKIDGHWRMVVGSRRKNRGIAHLYRSRDFKKWTKAKHPLHSVAKTGMWE
CVDFFPVSLTGEAAPDASAFGPNVKHVIKVSLDVTRFEYYTLGTYFPARDKYLVDKGSVD
GWDGLRLDYGNYYASKSFIDPIKNRRIIWGWTNESDTPQDDVKKGWAGIQTIPRKVWLDP
NRKQLLLWPIEEIETLRTQNVKLSNQELKLGEHVEVKGITAAQADVEVTFFIPSLDKAEP
FDPSWTNPQDLCGQKGSTVQGGVGPFGLLTLASEKLEEYTPVFFRLFKGQDKHVVLLCSD
AGSSSLRKVGLYKPSFAGFVDVDLADKKKLSLRSLIDNSMVESFGAGGKTCITSRVYPTL
AVFDDAHLFVFNNGTEKITADVEAWSMRKPNKMNN
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggaggttttgaaattcttctccctgtatttatttgtctgttgtttttatgtgataagc
aaccttaacaatggcgtcgaagcatctcacaaagtttataaagagttacaatctgaaagt
gcagttaatgtcaagcaactccacagaactggctatcactttcagcctcctaagaattgg
atcaatgatccaaatggtgtaatgcactacaatgggatttaccatgtattctaccaacac
aaccccaagggtgcagtttggggcaacattatttgggctcattcggtctccaaagacatg
gtcaattgggaagcacttgagccagcaatttgtccttcagagcactttgatataaatggg
tgttggtctggatcagccacaattcttccagacaatacgcctgtacttctttacacagga
attgatccgcaacacaaccaagtccaaaactatgctataccagcgaatttatcagaccca
tatttgcgtaaatggatcaagccagctgacaacccggtcgctgttgcagatgaaaccatg
aacaagacagccttccgtgacccatcaactgcatggaagattgatgggcattggcgaatg
gtggtaggtagcagaaggaaaaatagagggattgctcatttatacagaagtagggatttc
aagaaatggacaaaggcgaagcaccctttacattctgtggcaaagacaggtatgtgggaa
tgcgtagacttttttccagtgtcattgaccggtgaagctgcgccagacgcatctgctttt
gggcctaatgttaagcatgtaatcaaggtcagcttagatgttactaggtttgagtactac
actttaggtacatatttcccggctagggataaatatttggtggacaagggctctgttgat
ggttgggatggccttagactagactatggaaattactatgcttcaaagtcgtttattgac
cccataaagaacaggaggatcatatggggttggaccaacgagtctgatactcctcaagat
gatgttaagaaaggatgggctggtattcagacaattccaaggaaggtgtggcttgatcct
aacaggaagcaattgctgctctggcctattgaagaaatagaaacacttaggacccaaaat
gttaaattaagcaatcaagagctcaagttgggagaacatgttgaagtcaaaggaattact
gccgcccaggctgacgtcgaggttaccttcttcatacctagcttggacaaagctgaacca
tttgatcctagctggaccaatccgcaggatctttgtgggcaaaagggctcaactgttcaa
ggtggtgttggaccatttgggctactaacattagcttcagaaaagctagaagaatacacc
cccgtttttttcaggttatttaaaggtcaagacaagcatgttgttctcttatgctctgat
gctggaagctcttccttgaggaaagttgggctatataaaccatcatttgctggatttgtg
gatgtagatttggctgataagaagaagctttctcttaggagtttgattgataactcaatg
gtggagagttttggagctgggggaaaaacatgcatcacatcgagagtttatccaacgctg
gcagtttttgacgatgctcacttgtttgtattcaacaatgggactgagaaaatcactgca
gatgttgaagcctggagcatgagaaagcctaataagatgaacaattga

DBGET integrated database retrieval system