KEGG   Durio zibethinus (durian): 111315328Help
Entry
111315328         CDS       T05242                                 

Definition
(RefSeq) acid beta-fructofuranosidase-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00052  Galactose metabolism
dzi00500  Starch and sucrose metabolism
dzi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dzi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    111315328
   00500 Starch and sucrose metabolism
    111315328
Enzymes [BR:dzi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     111315328
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 111315328
NCBI-ProteinID: XP_022772704
Position
Unknown
AA seq 650 aa AA seqDB search
MVDTNPFLQASVSDGSDPIGPQVTRRKPIKEQLSIFFGLLAVGLCVAFLIGNNISDNAHE
HENECGSLASLNSMKPELLRPVSRGPAAGVSEKSNRFFAKVDGTFPAYPWNNSMLSWQRT
AFHFQPEKNWMNDPNGPLFYKGWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWLHLPLAM
VADQWYDKNGVWTGSATILHDGKIIMLYTGSTAEAVQVQNLAYPADHSDPLLIHWVKYPG
NPVLVPPPGIDNKDFRDPTTAWLTSEGKWRVTIGSKINKTGIALIYDTKDFINYEMLDGL
LHAVPGTGMWECVDFFPVSETEENGLDTSINGPGVKHVVKVSLDDERHDYYAIGTYLEKN
GTWIPDQPEIDVGIGIRYDYGIFYAAKTFYDQNKKRRVLWGWIGESDSEAADTQKGWASL
QSIPRTILFDQKTGTNLLQWPVEEIESLRLKRNEFNQVKVQAGSVVPLNVASATQLDIIA
EFEIDKEALERATGSNVTFSCRTSGGAAERGALGPFGLLVLADERLCERTPVYFYIAKGS
HGNLNTFFCNDQSRSSAASDVDKQIYGNFVPVLKDETLSLRILVDHSIIESFAQGGRTVI
TSRVYPTRAIYGAAKVFLFNNATEASVTASLKIWEMNSAFIRSYPRHQKF
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggtggatacaaatccattccttcaagcctccgtctctgatgggtctgatccaataggg
cctcaggtaactcgacggaaacccatcaaagagcagctttcaattttttttgggttgtta
gctgttggcttgtgtgtggcattcttgataggaaacaatatttcagataatgctcatgaa
catgaaaacgaatgcggttcattggcttcattgaactctatgaaacctgaacttttgcgg
ccggtgtcacgtggcccggctgccggtgtatcagagaaatcaaaccggttttttgccaag
gttgacgggacatttccggcgtatccatggaacaatagcatgttgtcatggcaaagaaca
gcttttcactttcaacctgaaaagaattggatgaatgatcctaatggtccattgttctac
aagggatggtatcatttcttctaccaatacaaccccaatgccgctgtgtggggtgacata
gtttggggtcatgctgtatccaaggacttgatccattggcttcacctcccattggcaatg
gttgctgaccagtggtacgataaaaatggtgtctggactggttctgccacaattctccat
gatgggaaaattattatgctatacacaggatccactgcggaggctgttcaggttcaaaac
cttgcttatcctgctgaccactctgaccctctgctcatccattgggtcaagtacccaggg
aaccctgttctagttccacccccaggcatagataacaaggatttccgtgatccaactacc
gcttggttaacctctgaagggaaatggcgcgttaccatagggtccaagataaataaaact
ggcatagctttgatatatgatactaaggacttcataaactatgagatgttagatgggtta
cttcatgctgtgcccggtaccggcatgtgggagtgtgtggacttcttccctgtttcagaa
acagaagaaaatggcttggacacatccattaatggacctggagtgaagcatgtggtcaag
gtaagcttggatgatgaaaggcatgattactatgccattgggacttaccttgagaagaat
ggtacatggattcctgaccaacctgaaatcgatgttggcattggaataaggtatgattat
ggaatattctatgctgccaagactttctatgatcagaataaaaagagaagagtgttgtgg
ggttggattggagaatctgatagtgaagcagcagatacgcaaaaaggatgggcatctctt
cagagcatcccaaggacaattttgtttgaccaaaagacgggtactaatttgcttcaatgg
ccagtggaagaaatagagagtttaaggttgaagaggaacgaatttaaccaggtgaaagtc
caggcaggatcagttgttcctttaaatgttgcttcagccacccagttggatatcatagcc
gagtttgagattgataaagaggctttggagagagcaactgggtccaatgtaacattcagc
tgtagaaccagtggtggagctgcagaacgtggggcactgggaccatttggtctgttggtg
cttgcagatgagagactctgtgagcggactcctgtctacttctacattgccaaaggatcc
catggcaatctcaatactttcttctgcaatgatcaatctcgatcatctgcagcatctgat
gttgataaacaaatttatgggaacttcgttccagtactaaaagatgaaaccttatccctc
agaatattggtggatcattcgataatcgaaagctttgctcaaggtgggaggacagtcatc
acatctcgggtttatccgacaagagcaatctatggagccgctaaagtgtttttattcaac
aatgctactgaagccagtgttaccgcctcacttaagatttgggaaatgaactctgcattc
attcggtcctatccacgtcatcagaagttctaa

DBGET integrated database retrieval system