KEGG   Escherichia coli ABU 83972: ECABU_c02920Help
Entry
ECABU_c02920      CDS       T01995                                 

Definition
putative sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
eab  Escherichia coli ABU 83972
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:eab00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ECABU_c02920
Enzymes [BR:eab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ECABU_c02920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
295190..296110
Genome map
AA seq 306 aa AA seqDB search
MDIAVIGSNMVDLITYTNQMPKEGETLEAPAFKIGCGGKGANQAVAAAKLNSKVLMLTKV
GDDIFADNTIRNLESWGINTTYVEKVPCTSSGVAPIFVNANSSNSILIIKGANKFLSPED
IDRAAEDLKKCKLIVLQLEVQLETVYHAIEFGKKNGIEVLLNPAPALRELDMSYACKCDF
FIPNETELEILTGMSVDTYDHIRLAARSLVDKGLNNIIVTMSEKGALWMTRDQEVHVPAF
KVNAVDTSGAGDAFIGCFSHYYVQSGDVEAALKKAALFAAFSVTGKGTQSSYPSIEQFNE
FLTLNE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggacattgcagttattggttccaatatggtggatctcattacttacacgaatcagatg
cctaaagaaggagaaactctggaagcacctgccttcaaaatcggatgtggtgggaaaggt
gctaatcaagcggtggcggcggctaaattgaattcaaaagtcctgatgctgactaaagta
ggtgatgatatttttgcggataatactattcgtaatctcgaatcatggggaattaatacc
acttatgttgagaaggtcccctgtaccagcagtggtgttgcaccgatctttgttaatgcc
aactcgagcaatagtatattaataattaagggagcgaataaatttctttccccggaagat
atcgatcgagctgcagaagatctgaaaaaatgcaaattgatcgttttacaactggaagtt
caactggaaacagtttaccacgcgattgagtttggtaagaaaaatggtattgaagtgtta
ttaaatccggctccggcattgcgtgagttagatatgtcttatgcctgcaaatgtgatttc
tttatcccgaatgaaacagaactggaaatattaaccggtatgtcggttgatacttatgat
catattcgtttggccgcacgttcgttagttgataaagggctgaacaatattattgttacc
atgagcgaaaaaggcgcattatggatgacccgtgatcaggaagtccatgttcctgcattc
aaagtaaatgctgttgatactagtggcgctggtgacgcatttattggttgcttttcccat
tattatgttcaaagcggtgatgttgaagccgctttgaaaaaagccgctctctttgccgct
ttcagcgtcacagggaaaggtacgcaatcatcttatccgagtattgaacaatttaatgaa
tttttaaccttaaacgaataa

DBGET integrated database retrieval system