KEGG   Escherichia coli ABU 83972: ECABU_c05540Help
Entry
ECABU_c05540      CDS       T01995                                 

Gene name
recR
Definition
(RefSeq) recombination and repair protein RecR
  KO
K06187  
recombination protein RecR
Organism
eab  Escherichia coli ABU 83972
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eab00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ECABU_c05540 (recR)
DNA repair and recombination proteins [BR:eab03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     ECABU_c05540 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ECABU_c05540 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
578062..578667
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKIRF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccgctgttaacacagcttatggaagcactgcgctgtctgccgggcgtt
ggcccgaagtcggcgcagcgtatggcgttcacgctgcttcagcgcgatcgtagcggcggg
atgcgtctggcgcaggcgctcacccgggcgatgtcggaaatcggtcactgcgccgattgc
cgcaccttcaccgaacaggaagtctgtaacatctgttcgaatccacgtcgtcaggaaaac
ggtcaaatctgcgtggtggagagtccggcggacatttacgccattgagcagacggggcag
ttttcaggtcgttattttgtgttgatgggacacctgtcaccgctggacggcatcggtcct
gatgatatcgggcttgatcgtctggaacagcgtctggcagaggaaaaaatcactgaagtg
atcctcgccaccaaccccacggttgaaggtgaagctaccgctaactacattgccgagctt
tgtgcgcaatatgacgtggaagccagccgaatcgctcatggcgtaccggttggcggcgaa
ctggaaatggtcgatggcaccacgctgtcacactcccttgccgggcgtcataagattcgt
ttttaa

DBGET integrated database retrieval system