KEGG   Escherichia coli ABU 83972: ECABU_c13850Help
Entry
ECABU_c13850      CDS       T01995                                 

Definition
phage lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
eab  Escherichia coli ABU 83972
Brite
Enzymes [BR:eab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     ECABU_c13850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1382939..1383436
Genome map
AA seq 165 aa AA seqDB search
MPPSLRKAVAAAIGGGAIAIASVLITGPSGNDGLEGVSYIPYKDIVGVWTVCHGHTGKDI
MLGKTYTKAECKALLNKDLATVARQINPYIKVDIPETMRGALYSFVYNVGAGNFRTSTLL
RKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREICLWGQQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcctccatcattacgaaaagccgttgctgctgctattggtggcggagcaattgctata
gcatcagtgttaatcactggcccaagtggtaacgatggtctggaaggtgtcagctacata
ccatacaaagatattgttggtgtatggactgtatgtcacgggcatacaggaaaagacatc
atgctcggtaaaacgtataccaaagcagaatgcaaagccctcctgaataaagaccttgcc
acggtcgccagacaaattaacccgtacatcaaagtcgatataccggaaacaatgcgcggc
gctctttactcattcgtttacaacgtgggtgctggcaatttcagaacatcgacgcttctt
cgcaaaataaaccagggcgatatcaaaggcgcatgtgatcagctacgtcgctggacatat
gctggcggtaagcaatggaaaggtctcatgactcgtcgtgagattgagcgtgaaatctgt
ttgtggggtcagcaatga

DBGET integrated database retrieval system