KEGG   Escherichia coli ABU 83972: ECABU_c15410Help
Entry
ECABU_c15410      CDS       T01995                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eab  Escherichia coli ABU 83972
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eab00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ECABU_c15410 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECABU_c15410 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECABU_c15410 (trpA)
Enzymes [BR:eab01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ECABU_c15410 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1521076..1521882)
Genome map
AA seq 268 aa AA seqDB search
MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLAD
GPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAECEK
VGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKI
IEQHINEPEKMLAALKAFVQPMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgaatctctgtttgcccagttgaaggagcgcaaagaaggcgcattcgtt
cctttcgtcaccctcggtgatccgggcattgagcagtcgttgaaaattatcgatacgcta
attgaagccggtgctgacgcgctggagttaggcatccccttctccgacccactggcggat
ggcccgacgattcaaaacgccacactgcgtgcttttgcggcgggagtaaccccggcgcag
tgctttgagatgctggcactcattcgccagaagcacccgaccattcccatcggccttttg
atgtatgccaacctggtgtttaacaaaggcattgatgagttttatgccgagtgcgagaaa
gtcggcgtcgattcggtgctggttgccgatgtgcccgtggaagagtccgcgcccttccgc
caggccgcgttgcgtcataatgtcgcacctatctttatttgcccgccgaatgccgacgat
gatttgctgcgccagatagcctcttacggtcgtggttacacctatttgctgtcgcgagcg
ggcgtgaccggcgcagaaaaccgcgccgcgttacccctcaatcatctggttgcgaagctg
aaagagtacaacgctgcgcctccattgcagggatttggtatttccgccccggatcaggta
aaagccgcgattgatgcaggagctgcgggcgcgatttctggttcggccatcgttaaaatc
atcgagcaacatattaatgagccagagaaaatgctggcggcactgaaagcttttgtacaa
ccgatgaaagcggcgacgcgcagttaa

DBGET integrated database retrieval system