KEGG   Escherichia coli ABU 83972: ECABU_c15430Help
Entry
ECABU_c15430      CDS       T01995                                 

Gene name
trpC
Definition
tryptophan biosynthesis protein trpCF (EC:4.1.1.48)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
eab  Escherichia coli ABU 83972
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eab00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ECABU_c15430 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECABU_c15430 (trpC)
Enzymes [BR:eab01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ECABU_c15430 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     ECABU_c15430 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1523087..1524448)
Genome map
AA seq 453 aa AA seqDB search
MMQTVLAKIVADKAIWVETRKEQQPLASFQNEVQPSTRHFYDALQGARTAFILECKKASP
SKGVIRDDFDPARIAAIYKHYASAISVLTDEKYFQGSFDFLPIVSQIAPQPILCKDFIID
PYQIYLARYYQADACLLMLSVLDDEQYRQLAAVAHSLEMGVLTEVSNEEELERAIALGAK
VVGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQVRELSHFANGFLIGSAL
MAHDDLNAAVRRVLLGENKVCGLTRGQDAKAAYDAGAIYGGLIFVATSPRCVNVEQAQEV
MAAAPLQYVGVFRNHDIADVADKAKVLSLAAVQLHGNEDQLYIDNLREALPAHVAIWKAL
SVGETLPARDFQHIDKYVFDNGQGGSGQRFDWSLLNGQSLGNVLLAGGLGADNCVEAAQT
GCAGLDFNSAVESQPGIKDARLLASVFQTLRAY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaaccgttttagcgaaaatcgtcgcagacaaggcgatttgggtagaaacccgc
aaagagcagcaaccgctggccagttttcagaatgaggttcagccgagcacgcgacatttt
tatgatgcacttcagggcgcacgcacggcgtttattctggagtgtaaaaaagcgtcgccg
tcaaaaggcgtgatccgtgatgatttcgatccggcacgcattgccgccatttataaacat
tacgcttcggcaatttcagtgctgactgatgagaaatattttcaggggagctttgatttc
ctccccatcgtcagccaaatcgccccgcagccgattttatgtaaagacttcattatcgat
ccttaccagatctatctggcgcgctattaccaggccgatgcctgcttattaatgctttca
gtactggatgacgaacaatatcgccagcttgcagccgtcgcccacagtctggagatgggt
gtgctgaccgaagtcagtaatgaagaggaactggagcgcgccattgcattgggggcaaag
gtcgttggcatcaacaaccgcgatctgcgcgatttgtcgattgatctcaaccgtacccgc
gagcttgcgccgaaactggggcacaacgtgacggtaatcagcgaatccggcatcaatact
tacgctcaggtgcgcgagttaagccacttcgctaacggctttctgattggttcggcgttg
atggcccatgacgatttgaacgccgccgtgcgtcgggtgttgctgggtgagaataaagta
tgtggcctgacacgtgggcaagatgctaaagcagcttatgacgcgggcgcgatttacggt
gggttgatttttgttgcgacatcaccgcgttgcgtcaacgttgaacaggcgcaggaagtg
atggctgcagcaccgttgcagtatgttggcgtgttccgcaatcacgatattgccgatgtg
gcggacaaagctaaggtgttatcgctggcggcagtgcaactgcatggtaatgaagatcag
ctgtatatcgacaatctgcgtgaggctctgccagcacacgtcgccatctggaaggcttta
agtgtcggtgaaactcttcccgcgcgcgattttcagcacatcgataaatatgtattcgac
aacggtcagggcgggagcggacaacgtttcgactggtcactattaaatggtcaatcgctt
ggcaacgttctgctggcggggggcttaggcgcagataactgcgtggaagcggcacaaacc
ggctgcgccgggcttgattttaattctgctgtagagtcgcaaccgggtatcaaagacgca
cgtcttttggcctcggttttccagacgctgcgcgcatattaa

DBGET integrated database retrieval system