KEGG   Escherichia coli ABU 83972: ECABU_c15920Help
Entry
ECABU_c15920      CDS       T01995                                 

Gene name
ycjM
Definition
alpha amylase family protein
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
eab  Escherichia coli ABU 83972
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:eab00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECABU_c15920 (ycjM)
Enzymes [BR:eab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     ECABU_c15920 (ycjM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1573215..1574921
Genome map
AA seq 568 aa AA seqDB search
MGPLPRKGNMKQKITDYLDEIYGGTFTATHLQKLVTRLESAKRLITQRRKKHWDESDVVL
ITYADQFHSNDLKPLPTFNQFYPQWLQRIFSHVHLLPFYPWSSDDGFSVIDYHQVASEAG
EWQDIQQLGECSHLMFDFVCNHMSAKSEWFKNYLQQQPGFEDFFIAIDPKTDLSAVTRPR
ALPLLTPFQMRDHSMRHLWTTFSDDQIDLNYRSPEVLLAMVDVLLCYLEKGAEYVRLDAV
GFMWKEPGTSCIHLEKTHLIIKLLRSIIDNVAPGTVIITETNVPHKDNIAYFGEGDDEAH
MVYQFSMPPLVLHAVQKQNVEALCAWAQNLTLPSSNTTWFNFLASHDGIGLNPLRGLLPE
NEILALVEVLQQEGALVNWKNNPDGTRSPYEMNVTYMDALSRRECSDEERCARFILAHAI
LLSFPGVPAIYIQSILGSRNDYAGVEKLGYNRAINRKKYSSKEITTELNNKATLRYSIYY
KLSHLITLRRSHKEFHPDNNFTIDAINSFVMRIQRSNADGDCLTGLFNVSENIQHINITD
LHGRDLISEVDILGNEITLHPWQVMWIK
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgggaccgctaccacggaaaggcaacatgaaacagaaaattacggattacctggacgaa
atctacggtggaacatttaccgcgactcatttacagaaacttgtaacgcgtcttgagagt
gcgaaacgattaattacacagcgacgtaaaaaacactgggatgaaagtgatgtcgtgtta
attacctatgccgatcaatttcacagtaatgatttaaagccactacccacatttaatcag
ttttaccctcaatggctgcaaagaattttttcacatgttcatttattacctttttatcca
tggtcatctgatgatggattttcggtaattgattatcatcaggtcgccagtgaagcgggg
gagtggcaggatattcagcaactcggtgaatgcagccatttaatgtttgattttgtctgc
aaccatatgtcggcaaaaagtgaatggtttaaaaactatttacaacagcagccaggtttt
gaagatttttttattgccattgatccgaaaaccgatctcagcgccgtcactcgcccgcgt
gcgttaccgttattaacgccattccagatgcgcgatcattcaatgcgccatttatggacc
acctttagcgacgatcaaattgacctcaattaccgtagccctgaagtgttgctggcgatg
gtggatgtattgctgtgctacctggaaaagggcgcagagtatgtccgtctggatgccgtt
ggctttatgtggaaagagccgggaacaagctgcatccatctggaaaaaacacatctgatt
atcaaactgttacggtcgattattgataacgtcgcgccaggcacagtgatcattaccgag
accaatgttccgcataaagacaacattgcttactttggcgaaggcgatgacgaagcgcat
atggtgtaccagttctcgatgccgccgctggtgctgcatgcggtgcaaaagcagaacgtt
gaggcactttgtgcgtgggcgcaaaacctgacactaccttccagcaacaccacctggttt
aacttccttgcctctcacgatggcatcgggcttaacccactgcgggggttgttgcccgaa
aacgaaatattagcgctggtcgaggtgttacagcaggaaggggcattagtaaactggaaa
aataatcccgacggtacgcgtagcccctatgaaatgaatgtcacctatatggatgcgttg
agccgccgtgagtgtagcgacgaagaacggtgtgccaggtttattctcgcccatgcgatt
ttgttaagttttcccggtgtgccagcgatatatattcaaagcattctggggtcgcgtaat
gattacgcaggtgtcgaaaaacttggatataatcgcgcgattaaccgtaaaaaatactct
agtaaagagataacgacagaactgaacaataaagcgacattaaggtattcgatatattat
aagttgtcgcatttaattacacttcgtcgcagtcataaagagtttcatccggataataat
ttcaccattgatgcgattaattcatttgtaatgcgaattcaaagaagcaatgcggatggc
gattgcctgacgggattgtttaatgtcagtgaaaatattcagcatataaatattactgac
ctgcacggtcgggatctgattagtgaagttgatatattgggtaatgaaataacactgcat
ccctggcaggttatgtggattaaataa

DBGET integrated database retrieval system