KEGG   Escherichia coli ABU 83972: ECABU_c17590Help
Entry
ECABU_c17590      CDS       T01995                                 

Gene name
bglA1
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eab  Escherichia coli ABU 83972
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:eab00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1757138..1758577)
Genome map
AA seq 479 aa AA seqDB search
MSGFKKDFLWGGAVAAHQLEGGWNEGGKGISIADVMTAGAHGVPREVTEGVIDGLNYPNH
EAIDFYHRYKTDIQLFAGMGFKCFRTSIAWTRIFPQGDEQEPNEEGLQFYDDLFDECLKQ
GMEPVVTLSHFEMPYHLVTKYGGWRNRKLIDFFIHFASTVFTRYKEKVKYWMTFNEINNQ
VNFSESLCPFTNSGILYSPEEDLNEREQIMYQVVHYELVASALAVQTGKLINPEFNIGCM
IAMCPIYPLTCAPNDMMMATKAMHRRYWFTDVHARGYYPQHMLNYFARKGFNLDITPDDN
AILARGCVDFIGFSYYMSFTTQFSPDNPQLDYVEPRDLVSNPYIDTSEWGWQIDPAGLRY
SLNWFWDHFQLPLFIVENGFGAVDQRQADGTVNDHYRIDYFSSHIREMKKAVVEDGVDLI
GYTPWGCIDLVSAGTGEMKKRYGMIYVDKDNEGKGTLERIRKASFYWYRDLIANNGENI
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggatttaaaaaagattttttatggggcggtgcggtagccgcacatcaattggaa
ggtggctggaatgaaggaggaaaaggcatcagtatcgctgatgtaatgactgctggcgct
cacggggtgccgcgtgaagtgacagaaggcgttatcgacggacttaattatcccaatcat
gaagcaattgatttttatcatcgctataaaacagatattcagttatttgccgggatggga
ttcaaatgctttcgaacttccattgcctggacacgaatctttccgcaaggtgacgaacag
gagccgaatgaagagggtttacaattttatgatgatctcttcgatgaatgcctgaagcag
ggaatggaacctgtggtgacgctttcgcattttgagatgccttatcatctggtgacaaaa
tatggtggctggcgaaaccgtaaactgatcgacttttttatccacttcgcatcaacggtc
ttcacgcgctataaagaaaaagtaaagtactggatgacgtttaacgaaatcaataatcag
gtgaatttcagcgaaagcctgtgtccatttactaattccggtatcttgtattcgccagag
gaagatctcaatgagcgcgaacaaataatgtaccaggtggtacattatgagttagttgcc
agtgccctggcggtacagactggaaaactgatcaatcctgaatttaatatcggctgtatg
attgctatgtgccccatctatcctctgacgtgtgcacccaacgatatgatgatggccacg
aaagcgatgcatcgtcgttactggtttactgatgttcatgctcgtggatattatccgcaa
catatgctgaattactttgcaaggaaaggattcaacctcgatatcacaccagatgataac
gcgattcttgccagaggttgtgtcgactttatcggctttagctactacatgtcttttacg
acgcaattttcgccagataatccgcaactggattatgttgaaccacgagatttggtcagc
aacccttatatcgatacatccgaatggggatggcaaattgatccggcagggctacgttat
tcactcaactggttctgggatcatttccagttgccgctgtttattgtcgaaaatggattt
ggtgcggttgaccagagacaagctgacggcacggtgaacgatcactatcgcattgattac
ttttcctcccatattcgggaaatgaaaaaagccgtagttgaagatggtgttgacttaatt
ggctacaccccgtggggttgcattgacctggtttctgccggaacaggagaaatgaaaaaa
cgctacggaatgatttatgtcgataaagacaacgaagggaagggaacgctggaacggata
cgtaaagcatcgttttactggtatcgggatctcatcgccaacaatggcgaaaatatatga

DBGET integrated database retrieval system