KEGG   Escherichia coli ABU 83972: ECABU_c28650Help
Entry
ECABU_c28650      CDS       T01995                                 

Gene name
acpS
Definition
holo-(acyl-carrier-protein) synthase (EC:2.7.8.7)
Orthology
K00997  
holo-[acyl-carrier protein] synthase [EC:2.7.8.7]
Organism
eab  Escherichia coli ABU 83972
Pathway
Pantothenate and CoA biosynthesis
Brite
KEGG Orthology (KO) [BR:eab00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    ECABU_c28650 (acpS)
Enzymes [BR:eab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.7  holo-[acyl-carrier-protein] synthase
     ECABU_c28650 (acpS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2934124..2934504)
Genome map
AA seq 126 aa AA seqDB search
MAILGLGTDIVEIARIEAVIARSGERLARRVLSDNEWEIWKTHHQPVRFLAKRFAVKEAA
AKAFGTGIRNGLAFNQFEVFNDELGKPRLRLWGEALKLAEKLGVVNMHVTLADERHYACA
TVIIES
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggcaatattaggtttaggtacggatattgtagagatcgctcgcatagaagcggtgatc
gcccgatccggtgagcgcctggcacgccgcgtattaagcgataacgaatgggaaatctgg
aaaacgcaccaccagccagtgcgttttctggcgaagcgttttgctgtgaaagaagcggcg
gcaaaagcatttggcacagggatccgcaatggtctggcgtttaatcagtttgaagtattc
aatgatgagctcggcaaaccacggctacggctatggggtgaggcattaaaactggcggaa
aagctcggcgttgtaaatatgcatgtaacgcttgccgatgagcgccactatgcttgtgcc
acggtaattattgaaagttaa

DBGET integrated database retrieval system