KEGG   Escherichia coli ABU 83972: ECABU_c31830Help
Entry
ECABU_c31830      CDS       T01995                                 

Gene name
bglA2
Definition
6-phospho-beta-glucosidase (EC:3.2.1.-)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eab  Escherichia coli ABU 83972
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:eab00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECABU_c31830 (bglA2)
Enzymes [BR:eab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ECABU_c31830 (bglA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3261159..3262592
Genome map
AA seq 477 aa AA seqDB search
MKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITKEVVPGKYYP
NHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDDMIDELL
KYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNEIN
NQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAAHRINPEMKVGCML
AMVPLYPYSCNPDDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGDLD
VLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRYAL
CELYERYQKPLFIVENGFGAYDKVEDDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLMGY
TPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGENL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaactcaccttaccgaaagatttcttatggggcggcgcagttgccgctcatcag
gtcgaaggcggctggaacaaaggcggcaaagggccgagcatttgtgacgttttgaccggt
ggcgcacacggcgtgccgcgcgaaatcaccaaagaagttgtgcctggcaaatactatcca
aaccatgaagccgttgatttttatggtcactacaaggaggacatcaagctatttgccgaa
atgggcttcaaatgttttcgtacttccatcgcctggacgcgcatttttccaaaaggcgat
gaagctcagccaaacgaagaagggctgaagttctacgatgatatgatcgatgaactgctg
aaatacaacatcgaaccggtgatcaccctctcccactttgaaatgccgctgcatctggtg
cagcaatacggtagctggaccaaccgtaaagtggttgatttctttgtccgtttcgcggaa
gtggtattcgaacgctataagcacaaagtcaaatactggatgaccttcaacgaaattaac
aaccagcgtaactggcgtgcaccgctgttcggttactgctgctccggcgtggtgtatacc
gaacatgaaaacccggaagagaccatgtatcaggtgctgcatcaccagtttgtcgccagc
gccctggcggtgaaagccgcgcatcgcatcaacccggagatgaaagtcggttgtatgctg
gcgatggtgccgctctatccttactcctgtaacccggacgatgtgatgtttgcccaggag
tcgatgcgcgaacgttacgtctttaccgatgtgcagttgcgtggctattacccgtcctat
gtgttgaacgagtgggaacgccgcggatttaacatcaaaatggaagacggcgatctggat
gtactgcgcgaaggcacctgcgattatctcggcttcagctattacatgaccaacgcggtg
aaggccgaaggtggcaccggcgatgcgatttctggtttcgaaggcagcgtaccgaatccg
tatgttaaagcgtctgactggggctggcagattgatccggttggtctgcgctacgcactt
tgcgagctgtatgagcgttaccagaagccgctgtttattgtcgaaaacggttttggcgct
tacgacaaagtggaagatgatggcagcatcaatgacgattaccgcattgattacctgcgt
gcccatattgaagagatgaaaaaagcggtgacttacgatggcgtggacctgatgggctac
acgccgtggggctgcatcgactgtgtgtcgttcaccaccgggcagtacagcaaacgctac
ggctttatctatgtgaataaacatgacgacggtactggcgatatgtcgcgttcacgtaag
aagagctttaactggtacaaagaggtgattgccagcaacggcgagaatctgtaa

DBGET integrated database retrieval system