KEGG   Escherichia coli ABU 83972: ECABU_c33740Help
Entry
ECABU_c33740      CDS       T01995                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
eab  Escherichia coli ABU 83972
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eab00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECABU_c33740 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECABU_c33740 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    ECABU_c33740 (glcB)
Enzymes [BR:eab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ECABU_c33740 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3440430..3442601)
Genome map
AA seq 723 aa AA seqDB search
MSQTITQGRLRINANFKRFVDEEVLPGTGLDAAAFWRNFDEIVHDLAPENRQLLAERDRI
QAALDEWHRSNPGPVKDKAAYKSFLRELGYLVPQPERVTVETTGIDSEITSQAGPQLVVP
AMNARYALNAANARWGSLYDALYGSDIIPQEGAMVSGYDPQRGEQVIAWVRRFLDESLPL
ENGSYQDVVAFKVVDKQLRIQLKNGKETTLRTPAQFVGYRGDAAAPTCILLKNNGLHIEL
QIDANGRIGKDDPAHINDVIVEAAISTILDCEDSVAAVDAEDKILLYRNLLGLMQGTLQE
KMEKNGRQIVRKLNDDRHYTAADGSEISLHGRSLLFIRNVGHLMTIPVIWDSEGNEIPEG
ILDGVMTGAIALYDLKVQKNSRTGSVYIVKPKMHGPQEVAFANKLFTRIETMLGMAPNTL
KMGIMDEERRTSLNLRSCIAQARNRVAFINTGFLDRTGDEMHSVMEAGPMLRKNQMKSTP
WIKAYERNNVLSGLFCGLRGKAQIGKGMWAMPDLMADMYSQKGDQLRAGANTAWVPSPTA
ATLHALHYHQTNVQSVQANIAQSEFNAEFEPLLDDLLTIPVAENANWSVEEIQQELDNNV
QGILGYVVRWVEQGIGCSKVPDIHNVALMEDRATLRISSQHIANWLRHSILTKEQVQASL
ENMAKVVDQQNAGDPAYRPMSGNFANSCAFKAASDLIFLGVKQPNGYTEPLLHAWRLREK
ESH
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaccataacccagggccgtttacgcattaacgccaattttaaacgttttgtg
gatgaagaagttttaccgggaacagggttggacgctgcggcgttctggcgcaattttgat
gagatcgttcacgatctggcaccagaaaatcgtcagttgctggcagaacgcgatcgcatt
caggcggcgcttgatgagtggcatcgcagcaatccggggccggtaaaagataaagcggcc
tataaatctttcctgcgtgaactgggctacctggtgccgcaaccggagcgcgtaacggtg
gaaaccacgggcattgacagcgaaatcaccagtcaggcggggccacagctggtggttccg
gcaatgaacgcccgctacgcgctgaacgcggcgaacgctcgctggggctcactgtacgat
gcgttatacggcagcgacatcatcccgcaggaaggggcgatggtcagcggctacgatccg
cagcgtggtgagcaggttatcgcctgggttcggcgtttcctcgatgaatcactaccgctg
gaaaacggcagctatcaggatgtggtggcgtttaaggtggtcgataaacaattacgcatc
cagttgaaaaatggtaaagaaaccacgttacgtaccccggcgcagtttgtcggttaccgt
ggcgatgccgctgcgccgacctgcattttgctgaaaaataacggtctgcatattgaactg
caaattgatgccaacgggcggattggcaaagacgatccggcgcatatcaacgatgttatc
gtcgaagcggccatcagtaccattctcgactgcgaagattcggtcgcggcggttgatgcg
gaagataaaatcctgctgtaccgcaacctgctgggcctgatgcaggggactctgcaagag
aaaatggaaaaaaacggtcggcaaatcgtgcgtaaactgaatgacgatcgtcattacacc
gccgccgatggctctgaaatttctctgcacggacgctcgctgctgtttatccgcaacgtg
ggtcatttgatgaccattcctgtgatttgggacagcgaaggcaatgaaatcccggaaggc
attcttgatggcgtcatgactggcgcgattgccctctatgatttaaaagtgcagaaaaac
tcgcgcactggcagtgtctatattgtgaaaccgaaaatgcacggtccgcaggaagtggcg
ttcgccaacaaactgtttacccgcattgagacaatgctcggtatggcaccgaataccctg
aaaatgggcattatggatgaagaacgtcggacctcgctgaacttgcgtagctgtatcgct
caggcgcgtaaccgcgtggcgttcatcaataccggtttcctcgaccgtaccggcgatgaa
atgcattcggtgatggaagctggcccgatgctgcgtaaaaaccagatgaaatcgacgccg
tggatcaaagcctacgaacgtaataacgtgctttccggtctgttctgtgggctgcgcggt
aaagcgcaaatcggtaaagggatgtgggcaatgccggacctgatggcagacatgtacagc
cagaagggcgaccaactgcgtgccggggcaaacacagcctgggttccgtcaccaaccgct
gctacgctccatgcgctgcactaccaccaaaccaacgtacagagcgtgcaggccaacatt
gcccagagcgagttcaatgctgaatttgaaccgctgctggacgatctgctgactattccg
gtggctgaaaacgctaactggtcggttgaagagatccaacaagagctggataacaacgtg
caggggattctggggtacgtggtgcgttgggtggagcaggggattggttgttcaaaagtg
ccggatattcacaacgtggcgctgatggaagaccgcgcaacgctgcgtatctccagccag
catatcgccaactggttacgtcacagtattctgaccaaagaacaggtgcaggcgtcgctg
gagaatatggcgaaagtggttgatcagcaaaacgctggcgatccggcttatcgtccgatg
tcggggaatttcgctaactcgtgtgcttttaaagctgccagcgatttaatcttcctcggc
gtgaaacagccaaacggctataccgaaccgttattacacgcctggcgtttacgcgaaaaa
gaaagtcattaa

DBGET integrated database retrieval system