KEGG   Escherichia coli ABU 83972: ECABU_c45890Help
Entry
ECABU_c45890      CDS       T01995                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
eab  Escherichia coli ABU 83972
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eab00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ECABU_c45890
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECABU_c45890
   00640 Propanoate metabolism
    ECABU_c45890
   00660 C5-Branched dibasic acid metabolism
    ECABU_c45890
Enzymes [BR:eab01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ECABU_c45890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4682446..4683615
Genome map
AA seq 389 aa AA seqDB search
MNLHEYQAKSLLAGMGMPCPKEIAIQQISQLADAWQHIACPSKGAVLKAQVHAGGRGKAG
GVKVLKQLPEAQAFVQQMLGSQLVTYQTGPEGQYVSSILLCENIYPVRQELYFGMVVDRE
SQRVTFIVSPEGGVEIEKVAHETPEKISSVSIDPLTGVQPCHIREMFAVLQLEHGLFAAF
SRLVNQAWKAFNELDFALLEINPLVLRETGEFMCADAKVSLDDNALYRHPELQVLRDETQ
EDPRESQAAKLDLNYVSLDGNIGCMVNGAGLAMATMDIIKLYGEQPANFLDVGGGATQER
VSEAFRLIVSDSKVKAILVNIFGGIVRCDMIARAIIHALNEARITLPVVVRLSGNNAAEG
QRLLAESGLTVEAVNSLDDAAKRIIALLN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacatgagtatcaggccaaatcgttactggctggcatggggatgccgtgtcca
aaagagatagccatccaacagatttcgcaactggcagatgcctggcaacatattgcttgc
ccgagtaaaggcgcggtacttaaagcgcaggtacatgctggtgggcgcggtaaagctggc
ggcgtaaaagtgcttaagcagctgccggaagcacaggcttttgtacagcaaatgttggga
tcgcaactggtgacttatcagaccgggccagaagggcagtatgtcagcagtattttgctg
tgcgaaaacatctatccggtacgccaggaactctattttggcatggtggtggatcgtgaa
agccagcgggtcacgtttattgtcagcccggaaggtggcgtggaaattgaaaaagtcgcc
catgagacaccggagaaaatcagcagtgtcagcattgatccactgacaggcgtgcagcct
tgccatatccgcgaaatgtttgctgttctgcaactggaacacgggctatttgctgccttt
agtcgcctggttaatcaggcgtggaaagcctttaacgaactggatttcgccctgctggaa
attaaccctctggtgttgcgggaaacgggcgaatttatgtgtgcagacgcgaaagtatcg
ctggatgataacgcgctgtatcgtcacccggaactccaggtgctacgtgatgaaacccag
gaagatccacgcgaaagccaggcagcgaagcttgatcttaattatgtctcgctggacgga
aatatcggctgcatggtcaatggtgcagggctggctatggcaaccatggacatcatcaag
ctatacggtgaacaacccgcaaacttcctggatgttggcggtggcgcaacccaggagcgc
gtcagtgaagcctttcggctgattgtttccgacagcaaagtgaaagccattctggttaat
atttttggtgggattgtccgttgcgacatgatcgccagagccattattcatgctctgaat
gaggcccgtatcaccctgcctgtcgtggtgcgtctctccggtaataacgctgccgaaggg
cagcggttactggcagaaagtggcctgacggtggaagccgtcaattctctggatgatgcc
gctaaacgcatcattgcgttactgaattaa

DBGET integrated database retrieval system