KEGG   Escherichia coli ABU 83972: ECABU_c46140Help
Entry
ECABU_c46140      CDS       T01995                                 

Gene name
acs
Definition
(GenBank) acetyl-Coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
eab  Escherichia coli ABU 83972
Pathway
eab00010  Glycolysis / Gluconeogenesis
eab00620  Pyruvate metabolism
eab00640  Propanoate metabolism
eab00680  Methane metabolism
eab01100  Metabolic pathways
eab01110  Biosynthesis of secondary metabolites
eab01120  Microbial metabolism in diverse environments
eab01130  Biosynthesis of antibiotics
eab01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eab00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECABU_c46140 (acs)
   00620 Pyruvate metabolism
    ECABU_c46140 (acs)
   00640 Propanoate metabolism
    ECABU_c46140 (acs)
  Energy metabolism
   00680 Methane metabolism
    ECABU_c46140 (acs)
Enzymes [BR:eab01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ECABU_c46140 (acs)
Lipid biosynthesis proteins [BR:eab01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ECABU_c46140 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADN49008
Position
complement(4707398..4709356)
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHTIPANIADRCLINPQQYEAMYQQSINAPDTFWGEQGKILDWITPYQKVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDASQSKHISYKELHRDVCRF
ANTLLELGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSS
RLVITSDEGVRAGRSIPLKKNVDDALKNPNVTSVEHVVVLKRTGGKIDWQEGRDLWWHDL
VEQASAQHQAEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNEGNPLEGATEGSLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaattcacaaacacaccattcctgccaacatcgcagaccgttgcctgataaac
cctcagcagtacgaggcgatgtatcaacaatctattaacgcaccagataccttctggggc
gaacagggaaaaattctcgactggatcacaccgtaccagaaggtgaaaaacacctccttt
gcccccggtaatgtgtccattaaatggtacgaggacggcacgctgaatctggcggcaaac
tgccttgaccgccatctgcaagaaaacggcgatcgtaccgccatcatctgggaaggcgac
gacgccagccagagcaaacatattagctataaagagctgcaccgcgacgtctgccgcttc
gccaataccctgctcgaactgggcattaaaaaaggtgacgtagttgcgatttatatgccg
atggtaccggaagccgcggtcgcgatgctggcctgcgcccgcattggcgcggtacattcg
gtgattttcggcggcttctcgccggaagccgttgccggacgcattatcgactccagttca
cgactggtgatcacttccgacgaaggtgtgcgtgccgggcgtagtattccgctgaagaaa
aacgttgatgacgcgctgaaaaacccgaacgtcaccagcgtagagcatgtggtggtactg
aagcgtactggtggaaaaattgactggcaggaagggcgcgacctgtggtggcacgacctg
gttgagcaagccagcgctcagcaccaggcggaagagatgaacgccgaagatccgctgttt
attctctatacctccggttctaccggtaagccaaaaggcgtgctgcacactaccggcggt
tatctggtgtacgcggcgctgacctttaaatatgtctttgattatcatccgggcgatatc
tactggtgcaccgccgatgtgggctgggttaccggacacagttatttgctgtatggcccg
ctggcctgcggcgcgaccacgctgatgtttgaaggcgtaccgaactggccgacgcctgcc
cgtatggcgcaggtggtggacaagcatcaggtcaatattctctataccgcgcccacggcg
attcgcgcgctgatggcggaaggcgataaagcgatcgaaggcaccgaccgttcgtcgctg
cgcattctcggttccgtgggcgagccaattaacccggaagcgtgggagtggtactggaag
aagatcggcaacgagaaatgcccggtggtcgacacctggtggcagaccgaaactggcggt
ttcatgatcacgccactgcctggcgctaccgagctgaaagccggttcggcaacacgtccg
ttcttcggcgtgcaaccagcgctggtcgataacgaaggtaacccgctggagggggccacc
gaaggcagtctggtgatcaccgactcctggccgggtcaggcgcgtacgctgtttggcgat
cacgaacgttttgagcagacctacttctccaccttcaaaaatatgtatttcagcggcgac
ggcgcgcgtcgcgatgaagatggctattactggatcaccgggcgcgttgacgacgtgctg
aacgtctccggtcaccgcctggggacggcagagattgagtcggcgctggtggcgcatccg
aaaattgccgaagccgctgtggtcggtattccgcacaatattaaaggtcaggcgatctac
gcctacgtcacgcttaatcacggggaggaaccgtcaccagaactgtacgcagaagtccgc
aactgggtgcgtaaagagattggcccgctggcgacgccagacgtgctgcactggaccgac
tccctgcctaaaacccgctccggcaaaattatgcgccgtattctgcgcaaaattgcggcg
ggcgataccagcaacctgggcgatacctcgacgcttgccgatcctggcgtagtcgagaag
ctgcttgaagagaagcaggccatcgcgatgccatcgtaa

DBGET integrated database retrieval system