KEGG   Escherichia coli ABU 83972: ECABU_c50170Help
Entry
ECABU_c50170      CDS       T01995                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
eab  Escherichia coli ABU 83972
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eab00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ECABU_c50170 (deoA)
Enzymes [BR:eab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     ECABU_c50170 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
5107528..5108901
Genome map
AA seq 457 aa AA seqDB search
MLIRFPDYLVSFPREVTLFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALA
MTIFFHDMTMPERVSLTMAMRDSGTVLDWKSLHLNGPIVDKHSTGGVGDVTSLMLGPMVA
ACGGYIPMISGRGLGHTGGTLDKLESIPGFDIFPDDNRFREIIKDVGVAIIGQTSSLAPA
DKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEA
IVGVANGAGVRTTALLTDMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEM
LISGKLAKDDAEARAKLQAVLDNGKAAEVFGRMVAAQKGPTDFVENYAKYLPTAMLTKAV
YADTEGFVSEMDTRALGMAVVAMGGGRRQASDTIDYSVGFTDMARLGDQVDGQRPLAVIH
AKDENSWQEAAKAVKAAIKLADKAPESTPTVYRRISE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgctcatccggttccccgattacctcgtctcttttccacgggaggttaccttgtttctc
gcacaagaaattattcgtaaaaaacgtgatggtcatgcgctgagtgatgaagaaattcgt
ttctttatcaacggcattcgcgacaacactatctccgaagggcagattgccgccctcgcg
atgaccattttcttccacgatatgacaatgcctgagcgtgtctcgctgaccatggcgatg
cgagattcaggaaccgttctcgactggaaaagcctgcatctgaatggcccgattgttgat
aaacactcgaccggcggtgtcggcgatgtgacttcgctgatgttggggccgatggtcgct
gcctgtggcggctatattccgatgatctccggtcgcggcctcggtcatactggcggtacg
ctcgacaaactggaatccatccctggcttcgacattttcccggatgacaaccgtttccgc
gaaattattaaagacgtcggcgtggcgattatcggccagaccagctcattggctccggcg
gataaacgtttctacgcgacccgcgatattaccgcaaccgtggattcaatcccgctgatc
accgcctctattctggcgaagaaactggcggaaggtctggacgcgctggtgatggacgtg
aaagtgggtagcggcgcgtttatgccgacctacgaactctctgaagcccttgccgaagcg
attgttggcgtggctaacggcgctggcgtgcgcaccaccgcgctgctcaccgatatgaat
caggtactggcctccagtgcaggtaacgcggttgaagttcgtgaagcggtgcagttcctg
acgggtgaatatcgtaacccgcgtctgtttgatgtcacgatggcactgtgcgtggagatg
ctgatctccggcaaactggcgaaagatgacgccgaagcgcgcgcgaaattacaggcggtg
ctggacaacggtaaagcggcagaagtctttggtcgtatggtagcggcacaaaaaggcccg
accgacttcgttgagaactacgcgaagtatctgccgacagcgatgctgacgaaagcagtc
tatgctgataccgaagggtttgtcagtgaaatggatacccgcgcgctggggatggcagtg
gttgcaatgggcggcggacgccgtcaggcatctgacaccatcgattacagcgtcggcttt
actgatatggcgcgtctgggcgaccaggtagacggtcagcgtccgctggcagttatccac
gcgaaagacgaaaacagctggcaggaagcggcgaaagcggtgaaagcggcaattaaactt
gccgataaagcaccggaaagcacaccaactgtctatcgccgtatcagcgaataa

DBGET integrated database retrieval system