KEGG   Ensifer adhaerens OV14: OV14_1459Help
Entry
OV14_1459         CDS       T03054                                 

Gene name
fadA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ead  Ensifer adhaerens OV14
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:ead00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OV14_1459 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    OV14_1459 (fadA)
   00640 Propanoate metabolism
    OV14_1459 (fadA)
   00650 Butanoate metabolism
    OV14_1459 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    OV14_1459 (fadA)
   00072 Synthesis and degradation of ketone bodies
    OV14_1459 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OV14_1459 (fadA)
   00310 Lysine degradation
    OV14_1459 (fadA)
   00380 Tryptophan metabolism
    OV14_1459 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OV14_1459 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OV14_1459 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    OV14_1459 (fadA)
Enzymes [BR:ead01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OV14_1459 (fadA)
Exosome [BR:ead04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OV14_1459 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(1418008..1419216)
Genome map
AA seq 402 aa AA seqDB search
MTKVFVYDHVRTPRGRGKKDGSLHEVPSVRLAAKMLEAVRDRNGLDTSTVDDIIMGCVDP
VMDAGAVIPKAAAFEAGYSTRAPGMQISRFCASGLDAVNFGAAKIAQGADDIVIAGGVES
MSRVGLGMSGGSWFMDPSVNLPAYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAAHS
WEKGYFKKSVVPVKDQNGLTILDRDEHMRPGTDMQALASLNPSFQMPGEMGGFEAVGIQA
HPEIEKINYVHHAGNSSGIVDGAAAVLLGSKAGGESMGLKPRARIRAFANIGSDPALMLT
GPVDVTEKLLKRADMKLSDIDLFELNEAFAAVVLRYMQAFDIPHDKINVNGGAIAMGHPL
GATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagtcttcgtttacgaccacgtgcgcacgccgcgcggccgtggcaagaaggac
ggctcgctgcacgaagtgccgtccgttcgccttgcggccaagatgctggaggccgtgcgc
gatcgcaacgggctcgatacgtcaaccgtcgacgacatcatcatgggctgcgtcgatccg
gtgatggatgccggcgcggttatcccgaaggcagccgccttcgaagcaggctattccacc
cgcgcgcccggcatgcagatctcgcgcttctgcgcgtcgggtctcgatgccgtcaacttc
ggcgcggcgaagatcgcccagggcgccgacgacatcgtcattgcaggcggcgtcgagagc
atgtcgcgcgtcggcctcggcatgtccggcggctcctggttcatggacccgtccgtcaac
ctgccggcctatttcatgccgcagggcgtctcggccgacctgatcgccaccaagtacggc
ttcagccgcgacgacgtcgatgcctacgccgtcgaaagccagaagcgcgcagcgcattcc
tgggaaaagggttacttcaagaagtcggtcgtgccggtgaaggaccagaacgggctgacc
attctcgaccgcgacgagcatatgcgtcccggcaccgacatgcaggcgctcgcctcgctc
aacccgtcgttccagatgccgggcgagatgggcggctttgaagccgtcggcatccaggcg
catccggaaatcgagaagatcaactacgtgcaccatgccggcaactcgtcgggcatcgtc
gatggcgccgcggccgtgctgctcggctccaaggccggcggcgaaagcatgggcctcaaa
ccccgcgcccgcatccgcgccttcgccaatatcggctccgacccggcgctgatgctgacc
ggcccggtcgacgtgaccgagaagttgcttaagcgcgccgacatgaagctctccgacatc
gacctcttcgagctcaacgaggcgtttgccgcggtcgtgctgcgctacatgcaggccttc
gacattccgcacgacaagatcaacgtcaacggcggcgcgatcgccatgggccatccgctc
ggcgctaccggtgcgatgatcctcggcacggtgctcgacgagctggaacggcgcgatctc
aacaccgcgctggtgacgttgtgcatcggcgccggcatgggcaccgcaacgatcatcgaa
agggtctga

DBGET integrated database retrieval system