KEGG   Ensifer adhaerens: OV14_a0504Help
Entry
OV14_a0504        CDS       T03054                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ead  Ensifer adhaerens
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ead00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    OV14_a0504
   00650 Butanoate metabolism
    OV14_a0504
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    OV14_a0504
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OV14_a0504
Enzymes [BR:ead01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     OV14_a0504
Amino acid related enzymes [BR:ead01007]
 Aminotransferase (transaminase)
  Class III
   OV14_a0504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
2:complement(564512..565852)
Genome map
AA seq 446 aa AA seqDB search
MYHFPDNLAEKMQYIASASNRTRAMTSLTDRKNAAISRGVGMTTQIYADRAENAEIWDKE
GNRYIDFASGIAVVNTGHRHPKVIAAVKAQLDRFTHTCHQVVPYETYVHLAERLNALAPG
DFAKKTIFVTTGAEAVENAVKIARAATGRQAVIAFGGGFHGRTFMGMALTGKVVPYKVGF
GAMPGDVFHAPFPIELHGVTVDQSLAALKKLFAADVDPGRVAAIIIEPVQGEGGFYPAPP
TFMKALREICDQHGILLIADEVQTGFARTGKMFAMDHHEVAPDLMTMAKSLAGGFPLAAV
TGRASIMDAPAPGGLGGTYGGNPLGIAAAHAVLDVIAEENLCERAELLGGRLKQRLAAIR
EQAPEIVDIRGPGFMNAVEFNDVKTNLPSADFANKVRLIALDKGLILLTCGVHGNVIRFL
APITIQDNVFAEALDILEASILEARG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacttcccagacaatcttgcagaaaaaatgcaatatattgcctccgccagcaac
aggacacgcgccatgactagcctcaccgatcgtaagaacgctgccatttcccgcggcgtc
ggcatgaccacgcagatctacgccgaccgtgcggagaacgccgaaatctgggacaaggaa
ggcaaccgctacatcgactttgcctcgggcattgcagtcgtcaacaccggccaccgccac
ccgaaggtgatcgccgccgtcaaggcgcagctcgatcgcttcacccacacctgccatcag
gtcgtgccctacgagacctatgtgcatctcgccgaacgcctcaatgcgcttgcgcccggc
gacttcgccaagaagacgatcttcgtcacgaccggcgcggaagccgttgaaaatgcagtg
aagatcgcccgcgcggcgactggccgccaggccgtgatcgcgttcggcggcggcttccat
ggccggaccttcatgggcatggcgctcaccggcaaggtggtcccgtacaaggtcggcttc
ggcgccatgccgggcgacgtcttccacgcccccttcccgatcgagctgcacggcgtcacc
gtcgaccagtcgctggcggcgctgaagaagctctttgccgccgatgtcgatccgggtcgc
gtggccgcaatcatcatcgagccggtgcagggcgaaggcggtttctacccggctccgccg
accttcatgaaggcgctgcgcgaaatctgcgaccagcacggcatcctcttgattgccgac
gaagttcagaccggctttgcccggacgggcaagatgtttgccatggaccatcatgaggtc
gcgcccgacctgatgacgatggcaaagagccttgccggcggcttcccgctcgctgccgtc
accggccgtgcctcgatcatggacgcaccggcgccgggcggccttggcggcacctatggc
ggcaacccgctcggcatcgccgccgcgcatgccgtactcgacgtcatcgcggaagagaac
ctctgcgaacgtgccgaactgctcggcggtcgtctgaagcagcgcctcgccgcaatccgc
gagcaggcgcctgagatcgtcgacatccgcggccccggcttcatgaacgccgtggaattc
aacgatgtgaagaccaatctgccgagcgccgactttgccaacaaggtgcgcctgattgcg
ctcgacaagggtctgattctgctgacctgcggcgtgcacggcaacgtcatccgtttcctc
gcgccgattaccatccaggacaacgtctttgccgaggcgctcgacatccttgaggcatcg
atcctcgaagcacgcggttga

DBGET integrated database retrieval system