KEGG   Enterobacter aerogenes KCTC 2190: EAE_00265Help
Entry
EAE_00265         CDS       T01529                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAE_00265 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAE_00265 (glk)
   00052 Galactose metabolism
    EAE_00265 (glk)
   00500 Starch and sucrose metabolism
    EAE_00265 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    EAE_00265 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EAE_00265 (glk)
   00524 Butirosin and neomycin biosynthesis
    EAE_00265 (glk)
Enzymes [BR:eae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     EAE_00265 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(48256..49221)
Genome map
AA seq 321 aa AA seqDB search
MTKFALVGDVGGTNARLALCDIASGEISRAKTYSGLDYPSLEAVVRVYLNEQAVKVDDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFAHLEIINDFTAVSMAIPMLKDEHLIQFG
GAQPAEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEGIILEELRNE
LGHVSAERVLSGPGLVNLYRAIVKSDGRLPENLQPKDVTERALADTCIDCRRALSLFCVI
MGRFGGNLALTLGTFGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKAYVQDIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatttgctttagtaggagacgtcggcggaactaacgcccgtctggcgttatgt
gatatcgcaagcggggagatttcccgcgctaaaacttattccgggctcgattatccaagc
cttgaggccgttgtacgcgtctatctcaacgaacaagccgtgaaggtcgatgatggctgc
atcgccattgcttgccccatcaccggcgactgggtagcgatgaccaaccatacctgggct
ttttctattgccgagatgaaaaagaacctcggattcgcgcatctggaaatcattaatgat
tttaccgcggtgtcgatggcgatcccaatgctcaaagacgagcatctgatccagttcggc
ggcgcgcaaccggcggaaggtaaaccgattgcagtctacggcgcaggtaccggtcttggc
gtagcgcacctggtacacgttgataaacgctgggtgagcctgcctggcgagggcggccac
gttgatttcgcgccgaacagcgaagaagagggcattattctcgaggagctacgcaacgag
ttaggccacgtgtccgccgaacgcgttctgtccggcccgggattagttaatctgtatcgg
gcgattgttaaatccgatggccgtttgccggagaacctgcaaccgaaggacgttaccgag
cgcgcgctggcggatacctgcattgattgtcgccgcgcgctgtcgttgttctgcgtcatt
atggggcgctttggcggtaacctggcgctgaccctcggcactttcggcggcgtgtacatc
gcaggcggtattgtcccgcgtttccttgagttctttaaggcgtcgggtttccgcggcggg
tttgaagataaagggcgctttaaagcctacgtgcaggatattccggtttatctcattgtc
catgataacccaggcctactgggctccggcgcgcatttgcgccagacgctggggcatatc
ctctaa

DBGET integrated database retrieval system