KEGG   Klebsiella aerogenes KCTC 2190: EAE_01855Help
Entry
EAE_01855         CDS       T01529                                 

Gene name
pcm
Definition
(RefSeq) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
eae  Klebsiella aerogenes KCTC 2190
Brite
Enzymes [BR:eae01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     EAE_01855 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 Methyltransf_32 CMAS DREV GCD14 NodS MTS
Motif
Other DBs
NCBI-GeneID: 10790539
NCBI-ProteinID: YP_004590585
UniProt: A0A0H3FJ49
Position
complement(384855..385481)
Genome map
AA seq 208 aa AA seqDB search
MVSKRVESLLNQLRTQGIVDERVLEAIAQVPREKFVDEAFEHKAWENTALPIGQGQTISQ
PYMVARMTELLELTPDSRVLEIGTGSGYQTAILAHLVHHVCSVERIKSLQWQARRRLKQL
DLHNVSTRHGDGWQGWQARAPFDAIIVTAAPPEIPAALMAQLDEGGVLVLPVGEEHQYLK
RIRRRGGEFFIDTVEAVRFVPLVRGELA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggtaagtaaacgtgttgaaagtttgttgaatcagctacgcactcagggcatcgtcgat
gagcgggtcctcgaggcaatcgcgcaggttccgcgcgaaaaattcgttgatgaagccttt
gaacataaggcgtgggaaaacaccgcgctgccgattggccaggggcaaaccatctcgcag
ccttatatggtggcgcggatgacggagcttctggaactgacgccggactcaagggtgctg
gaaattggcaccggctccggctatcagacggcgatcctggcgcaccttgtgcaccacgtc
tgctcggttgagcggattaagagcctgcagtggcaggcgcgccggcgtcttaaacaactt
gatttacataatgtttcaacccgtcatggcgatggatggcagggttggcaggctcgcgcg
ccttttgacgcgattatcgtcaccgccgcgccgccggaaattccggccgcgctgatggcg
cagcttgatgaaggcggcgtgctggttttgcctgtcggtgaagaacatcagtacctgaag
cggatccgtcgccgcggcggcgaatttttcatcgataccgtcgaagccgttcgctttgtt
ccgctcgtcagaggggaactggcctga

DBGET integrated database retrieval system