KEGG   Enterobacter aerogenes KCTC 2190: EAE_02095Help
Entry
EAE_02095         CDS       T01529                                 

Gene name
recD
Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eae00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EAE_02095 (recD)
Enzymes [BR:eae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     EAE_02095 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(439836..441683)
Genome map
AA seq 615 aa AA seqDB search
MTMDELLLAAAEQRLLRPLDVQFALMVAQDAPPAVKLAAALLSRDAGEGHVCLPLSRLNA
EEALSGKAGEIRDQLLAMAGEPQDWPQLLLSSSAVSRGDEPTPMILCGERLYLNRMWRNE
LTVARFFNETNRVLEVDEGRLTATLNELFPATDDIDWQKVAAAVALTRRISVISGGPGTG
KTTTVAKLLAALIQINDTSRCRIRLAAPTGKAAARLTESLGAALRKLPLSDEQKALVPAD
ASTLHRLLGAQPGSQRMRYHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPEHGRVIFLG
DRDQLASVEAGAVLGDICAWATSGYTAARAQELSRLTGATVPAGEGQMAGALRDSLCLLQ
KSYRFGSHSGIGSLARAVNAGARAEVKATLRQPFEDIVLQPLSTTEEYEAMLMAAQEGYG
RYLQLRREQAAPEQMIAAFGEFQLLCALREGPYGVSGVNEQLEQMLHRKRAITLPRHSRW
YDGRPVMISRNDSALGLFNGDIGIALERDGELRVWFPMPDGSIKSVQPSRLPEHDTAWAM
TVHKSQGSEFDHAALILPSRSVPLVTRELVYTAITRAKRRLSLYADEQVLAQAIVTRTER
RSGLAEIFAHGGKPG
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggatgaactgctgctggccgccgccgagcagcgtttgctgcgaccgctggac
gtacagtttgcgctgatggtggcgcaggatgcccctccggcagtgaagctggccgccgcg
ctgttgagccgggatgccggagaaggtcatgtctgcctgccgctgtcgcgcctcaacgct
gaagaagcgctaagcggcaaggccggcgagatccgcgaccagttgctggcgatggccgga
gagccgcaggactggcctcaattgttgctttcttcgtcagcggtgagccgcggcgacgaa
ccgacgccgatgattttatgtggcgaaaggctgtacctgaaccgcatgtggcgtaatgaa
ctcaccgtcgcccgcttttttaatgagacgaaccgggtactggaggttgatgaagggcgg
ttaacggcaaccctgaatgaactctttcctgcgaccgacgatatcgactggcaaaaagtc
gctgcggcggtggcgctgacccggcgcatttcggtgatctccggcggtcccggcaccggc
aagaccactaccgtcgcgaagctgctggcggcgctgattcagatcaacgacacgtcgcgc
tgtcgaattcggctggcggcgccgaccggcaaagccgcagcgcgcctgacggaatccctt
ggggcggcgttaagaaaacttccgcttagcgatgagcaaaaagcgctggttcccgccgat
gccagtaccttgcatcgcctgctgggggcgcagcccggcagccaacgcatgcgctaccac
gccgggaacccgctgcatctggatgtgctggtggtcgatgaagcctcaatgatcgactta
ccgatgatgtcgcgtctgattgatgctttgccggaacatgggcgggtgatttttctcggt
gaccgtgaccagcttgcctccgtggaagccggggcggtgcttggcgacatctgcgcctgg
gcgacatccggttataccgcggcgcgagcgcaagaactgtcgcgtttgaccggcgcaacg
gtgccggcgggggaggggcagatggccggggcgttgcgcgatagcctgtgcctgttgcaa
aaaagctaccgctttggcagccattccggtattggcagcctggcgcgggcggtcaatgcc
ggtgcgcgcgcagaagtgaaagcaacattacgccagccgtttgaggatatcgttctgcag
ccgctcagcaccaccgaggagtatgaagcgatgctgatggcggcacaggagggctacggt
cgttatctgcaactgcgccgcgagcaggccgcgccggagcagatgattgccgccttcggc
gaatttcagctgctgtgcgcgctgcgtgaagggccttacggggtaagcggcgtgaatgaa
cagctggagcagatgctccaccgtaagcgggcgattacgctaccgcgccattcacgctgg
tacgatggccgcccggtgatgatttcccgtaacgatagcgcgctggggctgtttaacggt
gatattggtattgcgctggaaagggacggcgaacttcgcgtgtggttcccaatgccggat
ggcagcattaaatcggtgcagccaagccgcctgccggaacatgataccgcctgggcaatg
acggtgcataagtcgcaagggtcggagttcgatcatgcggcgctgatcttgccttctcgt
agcgtaccgctggtgacccgcgagctggtttataccgcgattacccgcgccaaacggcgc
ctgtcgctttacgccgacgagcaggtactggcgcaagccatcgtgacgcgcaccgaacgg
cgcagcggcctggcggagattttcgcgcatggcggaaagcccggataa

DBGET integrated database retrieval system