KEGG   Enterobacter aerogenes KCTC 2190: EAE_02810Help
Entry
EAE_02810         CDS       T01529                                 

Definition
protein disulfide isomerase II DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
eae  Enterobacter aerogenes KCTC 2190
Brite
Enzymes [BR:eae01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     EAE_02810
Secretion system [BR:eae02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   EAE_02810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(590970..591683)
Genome map
AA seq 237 aa AA seqDB search
MKKGLLMFTLLAASLSGAAHADSAAIKQSLAKLGVQSTDIQPSPVSGMSTVLTDSGVLYV
TDDGKHIIQGPMYDVSGAQPVNVTNQLLVGKLNALTKEMIVYKAPKEQHVITVFTDITCG
YCHKLHEQMSDYNALGITVRYLAFPRQGLQSQAEQDMKAIWCAKDRNKALDDAMNGKGVQ
PASCSVDIAKHYTLGVQMGVNGTPAMVLSNGMVLPGYQGPKELKAFLDEHQKQTSGN
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtttattgatgttcaccctgctggcggcttcactctccggcgcggcgcat
gccgatagcgcggcgatcaaacagtcgctggcgaaactgggtgtgcagagcaccgatatc
cagccgtcgccggtttccgggatgagcacggtgctcaccgacagcggcgtgctgtacgtc
actgacgatggcaaacacattattcagggaccgatgtatgacgtcagcggcgcgcagccg
gttaacgtcaccaaccagttgctggtcggcaagctgaacgccttaaccaaagagatgatt
gtctataaagcgccgaaggagcagcatgtcattaccgtctttaccgacatcacctgcggc
tactgccacaagctgcacgagcagatgagcgactataacgcgctggggatcaccgtgcgc
tatctggccttcccgcgccaggggctgcaaagccaggccgagcaggatatgaaagcgatc
tggtgtgcgaaagatcgtaataaagcgctggatgacgccatgaatggtaaaggcgtacag
ccggcgagctgcagcgtagatatcgccaaacattataccctcggggtgcaaatgggcgtc
aacggcaccccggcgatggttctcagcaacggcatggtgctgccgggctatcaggggccg
aaagagcttaaagctttcctcgacgagcatcaaaaacagacaagcggtaactga

DBGET integrated database retrieval system