KEGG   Enterobacter aerogenes KCTC 2190: EAE_02855Help
Entry
EAE_02855         CDS       T01529                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAE_02855
Enzymes [BR:eae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     EAE_02855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
597229..598662
Genome map
AA seq 477 aa AA seqDB search
MKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITQQVEAGKYYP
NHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPQGDETQPNEEGLKFYDDMFDELL
KYNIEPVITLSHFEMPLHLVQQYGGWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNEIN
NQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAAQRINPEMQVGCML
AMVALYPYSCKPEDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGDAQ
ILREGTCAYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPHVKASDWGWQIDPVGLRYAL
CELYERYQKPLFIVENGFGAYDKVEADGSINDDYRIDYLRAHVEEMIKAVTYDGVDLMGY
TPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGENL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattgactcttcccaaagactttttatggggcggcgcggtcgccgcgcatcag
gttgaaggtggctggaataaaggcggcaaaggccccagcatctgcgacgttttaaccggc
ggggcgcacggcgtgccgcgcgaaatcacccaacaggtcgaagcgggtaagtattaccct
aaccatgaagcggttgatttttacggccactacaaagaagacatcaaattgttcgccgag
atgggtttcaaatgcttccgcacctctattgcctggacccgcatcttcccgcagggcgac
gaaactcagccaaatgaagaagggctgaaattctacgatgacatgtttgatgaactgctg
aagtacaacatcgagccagtgatcaccctttcccactttgaaatgccgctgcatctggta
cagcagtacggcggttggaccaaccgcaaagtggtcgatttctttgtgcgcttcgccgaa
gttgtctttgagcgttataagcacaaagtgaaatactggatgacctttaacgagatcaat
aaccagcgtaactggcgcgcgccgctgttcggctactgctgttccggcgtggtctatacc
gagcatgaaaacccggaagagaccatgtaccaggtgctgcatcaccagttcgtcgccagc
gcgctggcggtgaaagcggcgcagcgcatcaacccggaaatgcaggtcggctgcatgctg
gcgatggtcgccctctacccttactcctgcaaaccggaagatgtcatgtttgcccaggag
tcgatgcgcgaacgctatgtctttaccgatgtccagctgcgcggctactacccgagctat
gtgttgaatgaatgggaacgccgcggcttcaacatcaagatggaagacggcgacgcgcag
atcctgcgtgaaggcacctgcgcctatctcggcttcagctactacatgaccaacgcggtg
aaagccgaaggcggcaccggcgatgccatttccggcttcgaaggcagcgtgccgaacccg
catgtgaaagcctccgactggggctggcagattgacccggttggcctgcgctacgccctg
tgcgaattgtatgagcgctaccagaagccgctgtttatcgtggaaaacggctttggcgcc
tacgacaaagtagaagccgacggcagcatcaatgatgactaccgcatcgattatctgcgc
gcccacgtcgaagagatgattaaagcggtgacttatgacggcgttgatctgatgggttat
accccatggggctgcatcgactgcgtctccttcaccactggccagtacagcaaacgctac
ggcttcatctacgttaataaacacgacgacggcaccggcgatatgtcccgctcgcgcaag
aagagctttaactggtacaaagaagtcattgccagcaacggcgagaatctgtaa

DBGET integrated database retrieval system