KEGG   Klebsiella aerogenes KCTC 2190: EAE_05130Help
Entry
EAE_05130         CDS       T01529                                 

Gene name
cysG
Definition
(RefSeq) siroheme synthase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00860  Porphyrin and chlorophyll metabolism
eae01100  Metabolic pathways
eae01110  Biosynthesis of secondary metabolites
eae01120  Microbial metabolism in diverse environments
Module
eae_M00121  Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EAE_05130 (cysG)
Enzymes [BR:eae01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     EAE_05130 (cysG)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     EAE_05130 (cysG)
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     EAE_05130 (cysG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M Shikimate_DH Radical_SAM
Motif
Other DBs
NCBI-GeneID: 10791199
NCBI-ProteinID: YP_004591232
UniProt: A0A0H3FT34
Position
1052316..1053689
Genome map
AA seq 457 aa AA seqDB search
MDHLPIFCQLRDRDCLLVGGGDVAERKARLLLDAGARLTVNSRQFTPQFQVWAEAQMLTL
AQGDFNPALLDNCWLAIAATDDDVVNQQVSEAAESRRIFCNVVDAPRQASFIMPSIIDRS
PLMVAVSSGGTSPVLARLLREKLESLLPLHLGQIARYAGQLRSRVKKQFATVGERRRFWE
KLFVNDRLAQSLANDDRQAVADTTEQLLNEPLEHRGEVVLVGAGPGDAGLLTLKGLQQIQ
QADVVVYDRLVSDDIMNLVRRDADRVFVGKRAGYHCVPQEEINQILLREAQSGKRVVRLK
GGDPFIFGRGGEELETLCAAGIPFSVVPGITAASGCSAYSGIPLTHRDFAQGVRLITGHL
KTGSDLDWQNLAAEKQTLVFYMGLNQAAAIREKLIAHGMAADMPAAIVENGTAVNQKVVT
GTLDRLDILAQQMASPALIIVGRVVALRDKLNWFSHH
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtggaccacttacctattttttgccaactacgcgatcgcgactgcttgctggtcggcggc
ggcgatgtcgctgaacgcaaggcgcgtctgttgctcgacgcaggcgcccggttaacggtg
aactcacgccagtttactccgcagtttcaggtgtgggccgaggcgcaaatgctgacgctg
gcgcagggcgatttcaatcctgcgctgctcgataactgctggctggcgatcgccgccacc
gacgatgatgtcgttaatcagcaggtcagcgaggccgctgaatcacggcgtattttctgc
aacgtggtggatgcgccccgtcaggccagctttatcatgccgtcaattatcgaccgctcg
ccgctgatggtcgccgtgtcttccggcggtacctccccggtgctggcgcgcctgctgcgt
gaaaagctcgaatcgctgctgccgctgcacctcgggcaaatcgcccgctatgccgggcag
ttgcgctcaagggtgaaaaaacagttcgctaccgtcggcgagcgccgccgcttctgggaa
aagctgtttgttaacgatcgtctcgcccaatcgctggcgaacgatgatcgtcaggccgtt
gccgacaccacggaacagttattgaatgagccgctggaacatcgcggcgaagtggtgctg
gtgggcgccggtccgggcgatgccgggctgctcaccctcaagggactgcagcagatccag
caggccgatgtagtggtttatgaccgactggtctccgacgacattatgaacctggtgcgc
cgtgacgccgatcgggtgtttgtcggcaaacgtgcaggctatcactgcgtgccgcaggag
gagattaaccaaatcctgctgcgcgaagcgcaaagcggcaaacgtgttgtacgtctgaaa
ggcggcgatccgtttatttttggccgcggcggcgaagagctggagaccctctgcgcggca
ggtattccgttctcggtggtgccggggatcaccgccgcctccggctgctcggcctactcc
ggcattccgctcacccaccgcgatttcgcccagggcgtacgcctgatcaccggccatctg
aaaaccggtagcgatctcgactggcaaaatctggcggcggaaaaacagacgctggtgttc
tatatggggctaaaccaggcggcggcgatccgcgaaaaactgatcgcccacggcatggcg
gcggatatgccggccgctatcgtcgaaaacggcaccgcggtcaaccagaaggtcgtcacc
ggcactctggatcggctggatatcctggcgcagcagatggccagcccggcgttgattatc
gtgggccgcgtggtggcgctacgcgacaagctgaactggttttctcaccattaa

DBGET integrated database retrieval system