KEGG   Enterobacter aerogenes KCTC 2190: EAE_05130Help
Entry
EAE_05130         CDS       T01529                                 

Gene name
cysG
Definition
siroheme synthase
Orthology
K02302  
uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EAE_05130 (cysG)
Enzymes [BR:eae01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     EAE_05130 (cysG)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     EAE_05130 (cysG)
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     EAE_05130 (cysG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1052316..1053689
Genome map
AA seq 457 aa AA seqDB search
MDHLPIFCQLRDRDCLLVGGGDVAERKARLLLDAGARLTVNSRQFTPQFQVWAEAQMLTL
AQGDFNPALLDNCWLAIAATDDDVVNQQVSEAAESRRIFCNVVDAPRQASFIMPSIIDRS
PLMVAVSSGGTSPVLARLLREKLESLLPLHLGQIARYAGQLRSRVKKQFATVGERRRFWE
KLFVNDRLAQSLANDDRQAVADTTEQLLNEPLEHRGEVVLVGAGPGDAGLLTLKGLQQIQ
QADVVVYDRLVSDDIMNLVRRDADRVFVGKRAGYHCVPQEEINQILLREAQSGKRVVRLK
GGDPFIFGRGGEELETLCAAGIPFSVVPGITAASGCSAYSGIPLTHRDFAQGVRLITGHL
KTGSDLDWQNLAAEKQTLVFYMGLNQAAAIREKLIAHGMAADMPAAIVENGTAVNQKVVT
GTLDRLDILAQQMASPALIIVGRVVALRDKLNWFSHH
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtggaccacttacctattttttgccaactacgcgatcgcgactgcttgctggtcggcggc
ggcgatgtcgctgaacgcaaggcgcgtctgttgctcgacgcaggcgcccggttaacggtg
aactcacgccagtttactccgcagtttcaggtgtgggccgaggcgcaaatgctgacgctg
gcgcagggcgatttcaatcctgcgctgctcgataactgctggctggcgatcgccgccacc
gacgatgatgtcgttaatcagcaggtcagcgaggccgctgaatcacggcgtattttctgc
aacgtggtggatgcgccccgtcaggccagctttatcatgccgtcaattatcgaccgctcg
ccgctgatggtcgccgtgtcttccggcggtacctccccggtgctggcgcgcctgctgcgt
gaaaagctcgaatcgctgctgccgctgcacctcgggcaaatcgcccgctatgccgggcag
ttgcgctcaagggtgaaaaaacagttcgctaccgtcggcgagcgccgccgcttctgggaa
aagctgtttgttaacgatcgtctcgcccaatcgctggcgaacgatgatcgtcaggccgtt
gccgacaccacggaacagttattgaatgagccgctggaacatcgcggcgaagtggtgctg
gtgggcgccggtccgggcgatgccgggctgctcaccctcaagggactgcagcagatccag
caggccgatgtagtggtttatgaccgactggtctccgacgacattatgaacctggtgcgc
cgtgacgccgatcgggtgtttgtcggcaaacgtgcaggctatcactgcgtgccgcaggag
gagattaaccaaatcctgctgcgcgaagcgcaaagcggcaaacgtgttgtacgtctgaaa
ggcggcgatccgtttatttttggccgcggcggcgaagagctggagaccctctgcgcggca
ggtattccgttctcggtggtgccggggatcaccgccgcctccggctgctcggcctactcc
ggcattccgctcacccaccgcgatttcgcccagggcgtacgcctgatcaccggccatctg
aaaaccggtagcgatctcgactggcaaaatctggcggcggaaaaacagacgctggtgttc
tatatggggctaaaccaggcggcggcgatccgcgaaaaactgatcgcccacggcatggcg
gcggatatgccggccgctatcgtcgaaaacggcaccgcggtcaaccagaaggtcgtcacc
ggcactctggatcggctggatatcctggcgcagcagatggccagcccggcgttgattatc
gtgggccgcgtggtggcgctacgcgacaagctgaactggttttctcaccattaa

DBGET integrated database retrieval system