KEGG   Enterobacter aerogenes KCTC 2190: EAE_05130Help
Entry
EAE_05130         CDS       T01529                                 

Gene name
cysG
Definition
siroheme synthase
Orthology
K02302  
uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:eae00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1052316..1053689
Genome map
AA seq 457 aa AA seqDB search
MDHLPIFCQLRDRDCLLVGGGDVAERKARLLLDAGARLTVNSRQFTPQFQVWAEAQMLTL
AQGDFNPALLDNCWLAIAATDDDVVNQQVSEAAESRRIFCNVVDAPRQASFIMPSIIDRS
PLMVAVSSGGTSPVLARLLREKLESLLPLHLGQIARYAGQLRSRVKKQFATVGERRRFWE
KLFVNDRLAQSLANDDRQAVADTTEQLLNEPLEHRGEVVLVGAGPGDAGLLTLKGLQQIQ
QADVVVYDRLVSDDIMNLVRRDADRVFVGKRAGYHCVPQEEINQILLREAQSGKRVVRLK
GGDPFIFGRGGEELETLCAAGIPFSVVPGITAASGCSAYSGIPLTHRDFAQGVRLITGHL
KTGSDLDWQNLAAEKQTLVFYMGLNQAAAIREKLIAHGMAADMPAAIVENGTAVNQKVVT
GTLDRLDILAQQMASPALIIVGRVVALRDKLNWFSHH
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtggaccacttacctattttttgccaactacgcgatcgcgactgcttgctggtcggcggc
ggcgatgtcgctgaacgcaaggcgcgtctgttgctcgacgcaggcgcccggttaacggtg
aactcacgccagtttactccgcagtttcaggtgtgggccgaggcgcaaatgctgacgctg
gcgcagggcgatttcaatcctgcgctgctcgataactgctggctggcgatcgccgccacc
gacgatgatgtcgttaatcagcaggtcagcgaggccgctgaatcacggcgtattttctgc
aacgtggtggatgcgccccgtcaggccagctttatcatgccgtcaattatcgaccgctcg
ccgctgatggtcgccgtgtcttccggcggtacctccccggtgctggcgcgcctgctgcgt
gaaaagctcgaatcgctgctgccgctgcacctcgggcaaatcgcccgctatgccgggcag
ttgcgctcaagggtgaaaaaacagttcgctaccgtcggcgagcgccgccgcttctgggaa
aagctgtttgttaacgatcgtctcgcccaatcgctggcgaacgatgatcgtcaggccgtt
gccgacaccacggaacagttattgaatgagccgctggaacatcgcggcgaagtggtgctg
gtgggcgccggtccgggcgatgccgggctgctcaccctcaagggactgcagcagatccag
caggccgatgtagtggtttatgaccgactggtctccgacgacattatgaacctggtgcgc
cgtgacgccgatcgggtgtttgtcggcaaacgtgcaggctatcactgcgtgccgcaggag
gagattaaccaaatcctgctgcgcgaagcgcaaagcggcaaacgtgttgtacgtctgaaa
ggcggcgatccgtttatttttggccgcggcggcgaagagctggagaccctctgcgcggca
ggtattccgttctcggtggtgccggggatcaccgccgcctccggctgctcggcctactcc
ggcattccgctcacccaccgcgatttcgcccagggcgtacgcctgatcaccggccatctg
aaaaccggtagcgatctcgactggcaaaatctggcggcggaaaaacagacgctggtgttc
tatatggggctaaaccaggcggcggcgatccgcgaaaaactgatcgcccacggcatggcg
gcggatatgccggccgctatcgtcgaaaacggcaccgcggtcaaccagaaggtcgtcacc
ggcactctggatcggctggatatcctggcgcagcagatggccagcccggcgttgattatc
gtgggccgcgtggtggcgctacgcgacaagctgaactggttttctcaccattaa

DBGET integrated database retrieval system