KEGG   Enterobacter aerogenes KCTC 2190: EAE_05395Help
Entry
EAE_05395         CDS       T01529                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EAE_05395
Enzymes [BR:eae01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     EAE_05395
Exosome [BR:eae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EAE_05395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1114418..1116601)
Genome map
AA seq 727 aa AA seqDB search
MSNRIDRDVINALIAGHFADPFSVLGMHRTEAGLEVRALLPDATEVWVIEPKTGRKVGKL
ECLDSRGFFSGLLPRRKNAFRYQLAVTWHGQQNLIDDPYRFGPLLQDVDAWLLSEGTHLR
PYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRLRKESGIWELFIP
GALNGQLYKFELIDAHGNLRVKADPYAFESQMRPESASLICDLPPKVEQPAARKAANQFD
APISIYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMGFTHLELLPVNEHPFDGSWGY
QPTGLYAPTRRFGTREDFRYFIDAAHAAGLNVILDWVPGHFPADDFALASFDGTSLYEHS
DPREGYHQDWNTLIYNYGRREVSNYLVGNALYWIERFGIDALRVDAVASMIYRDYSRKAG
EWIPNEYGGRENLEAIEFLRNTNRILGEQTPGAVTMAEESTDFAGVTRPPADGGLGFWFK
WNLGWMHDTLDYMKLDPVHRRYHHDKMTFGMLYNYTENFVLPLSHDEVVHGKKSILDRMP
GDAWQRFANLRAYYGWLFAFPGKKLLFMGNEFAQGREWNHDASLDWHLLEGGDNWHHGVQ
RLVRDLNHTYRHHKALHELDFDPYGFEWLVVDDHERSVFIFVRRDKAGNEIIVASNFTPV
PRHNYRFGINQPGRWREELNTDSMHYHGSNAGNGGVVESEPVASHGRQHSLSITLPPLAT
IWLVREA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatcgaatcgatagagacgtgattaatgcgctgattgcaggtcatttcgcggat
cccttttccgtgcttggcatgcaccgtaccgaggcggggctggaagttcgcgcattatta
ccagatgccaccgaagtgtgggttattgaaccgaaaaccgggcgtaaagtcggcaaactc
gaatgcctcgactcgcgcggattctttagcggcctgctgccgcggcgtaaaaacgctttt
cgctaccagctggccgtcacctggcatggacagcaaaacctgattgacgacccttaccgt
ttcggcccgctgctgcaggacgttgatgcctggctgttgtccgagggaacgcacctgcgc
ccttacgaaaccctgggcgcgcacgccgacactatggatggcgtcaccggtacacgcttt
tcggtctgggcgccaaacgcccgccgggtctcggtggtggggcaatttaactactgggat
ggccgacgccatcccatgcgcctgcgtaaagagtccggtatctgggaactcttcattccc
ggcgcgcttaatggccaactgtataaattcgagctgatcgacgctcatggcaatctacgc
gtcaaagccgatccttacgcctttgagtcgcagatgcgcccggaaagcgcgtcgcttatc
tgcgatttgccgccgaaagtcgaacagccggcggcgcgcaaagccgcgaaccagtttgat
gcgccgatctctatttatgaagtgcacctcggttcctggcgccgccataccgacaataac
ttctggcttagctaccgcgaactggcagaccaactggtgccatatgcaaaatggatgggc
ttcacccacctcgaactgctgccggtgaacgaacacccgttcgacggtagctggggttac
cagccgaccggcctctacgcgccgacacgccgcttcggcacccgtgaagatttccgctat
ttcatcgatgccgcccacgccgcaggccttaacgtgatactcgattgggttccgggtcat
tttccggcggatgattttgcgctggcctcatttgacggcacctcgctgtatgaacacagc
gatccgcgcgaaggttatcaccaggactggaatacccttatctataactacggccgccgc
gaagtcagcaattacctggtgggtaacgcgctgtactggatcgagcgcttcggcattgat
gcgctgcgcgtcgacgcggtggcgtcgatgatctaccgcgactatagccgtaaagcgggc
gagtggatccccaacgaatacggcgggcgggaaaatctcgaagcgatcgagtttctgcgt
aacaccaaccgtattctcggcgagcagacgccaggggcggtaacgatggcggaagagtcc
accgattttgccggcgtgacgcgcccgcccgccgacggcggcctcggcttctggttcaaa
tggaatctcggttggatgcacgacacgctggactatatgaagctcgatcctgtccatcgt
cgctaccatcacgacaaaatgaccttcggcatgctctacaactacaccgagaacttcgtg
ctgccgctctcccacgatgaagtggtgcacggcaaaaaatcgattctcgaccgcatgccg
ggggacgcatggcagcgctttgccaacctgcgcgcctactacggctggctgtttgccttt
ccgggcaaaaagctgctgtttatgggcaatgaattcgcccagggccgcgagtggaaccac
gacgccagtctcgactggcatctgctggagggcggcgacaactggcaccacggcgtccag
cgactggtgcgcgacctgaaccacacctaccgtcaccataaagcgctgcacgagcttgat
ttcgatccctacggcttcgaatggctggtggtcgacgatcatgagcgttcggtatttatc
tttgtgcgccgcgataaagccggcaatgagattatcgtcgccagcaactttaccccggtg
ccgcggcacaactaccgtttcggcatcaaccagccgggacgctggcgcgaagaattgaac
accgactcgatgcattatcacggcagtaacgccggaaatggcggagtggttgagagcgag
cccgtcgccagccatggccgtcagcattcgttgtcgattaccctgccgccgctggcgacc
atctggctggtacgggaggcctga

DBGET integrated database retrieval system