KEGG   Enterobacter aerogenes KCTC 2190: EAE_05915Help
Entry
EAE_05915         CDS       T01529                                 

Definition
endo-1,4-D-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:eae00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1224600..1225706)
Genome map
AA seq 368 aa AA seqDB search
MNAFRGVLLSVLMLAAGQVSAACQWPAWEQFKKAYVSAEGRVIDPSDARKITTSEGQSYA
LFFALAANDRQGFDKLFQWTQNNLAQGDLRAHLPGWLWGKKSEDEWTVLDSNSAADSDLW
IAWALLEAGRLWKVDNYTEVGKALLARIADEEVADVPGLGPSVLPGKVGFADDKGWRFNP
SYLPPQLATYFTRFGAPWPKIRDSNLRLLLETAPKGFSPDWVRYEKGSGWQLKTDKPIIG
SYDAIRVYLWVGMLNNADKQKAPLLARFKPMAVQTIKQGLPPEKTNIASGKTTGEGPVGF
SAAMLPFLQDDDARALQRQRVADHYPDADAYYSAVLTLFGQGWDQHRFRFAAGGELQPDW
NQACASSH
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcatttcgtggggtacttctctcggtattgatgctggcggcggggcaggttagc
gccgcctgccagtggcccgcctgggagcagtttaaaaaagcgtatgtcagcgccgaaggg
cgggtcatcgaccccagcgatgcgcgcaaaatcaccacctccgaagggcaaagctatgcg
ctgttcttcgctctcgcggccaacgatcgccagggcttcgataagctgttccagtggacg
cagaacaacctggcgcagggcgatctgcgcgcccatctgccgggatggctatgggggaaa
aagagcgaggatgaatggacggtgctggacagcaattcggctgcggattctgatttgtgg
atcgcctgggcgctgctggaagccggacgcctgtggaaggttgataactatactgaggta
ggaaaagcgctgctggcgcggattgccgatgaagaagtcgctgatgttccggggctcggg
ccgtcggtactgccggggaaagttgggttcgcggacgacaagggttggcgctttaatcca
agttatctgccgccgcagctcgccacctattttacccgctttggcgcgccgtggccgaag
atccgcgacagcaatctgcgactgctgctggaaacggcgccaaaaggcttctcgccggac
tgggtgcgctatgagaaaggtagcggctggcagttgaaaaccgataaaccgattattggc
agctatgacgctatccgcgtctatctgtgggtcggcatgctcaataacgccgataaacaa
aaagcgccgctgttggcgcgtttcaaaccgatggcggttcagacgatcaaacagggatta
ccgccggaaaaaaccaatatcgccagcgggaaaacgactggcgaggggccggttggcttc
tccgccgccatgctgccatttttacaagatgacgacgcccgcgcgctacaacgccaacgg
gtcgccgatcattatcccgacgcggacgcctactacagcgcggtgctgacgctgttcggc
caggggtgggatcaacatcgttttcgtttcgccgcgggtggcgaattacaacctgactgg
aaccaggcatgcgcaagttctcactaa

DBGET integrated database retrieval system