KEGG   Enterobacter aerogenes KCTC 2190: EAE_06120Help
Entry
EAE_06120         CDS       T01529                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EAE_06120
   00051 Fructose and mannose metabolism
    EAE_06120
Enzymes [BR:eae01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     EAE_06120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1268939..1270261)
Genome map
AA seq 440 aa AA seqDB search
MQTYFDQLDRVRYEGPKSTNPLAFRHYNPDELVLGKRMEDHLRFAACYWHTFCWNGADMF
GVGSFDRPWQQPGEALEMAKRKAEVAFEFFHKLNVPYYCFHDVDVSPEGASLKEYSNNFA
QMVDVLAEKQQQSGVKLLWGTANCFTNPRYGAGAATNPDPEVFSWAATQVVTAMNATHKL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQLVVEHKHKIGFQGTLLIEPKPQEPTK
HQYDYDASTVYGFLKQFGLEKEIKLNIEANHATLAGHSFHHEIATAIALGLFGSVDANRG
DAQLGWDTDQFPNSVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALSLKVAARMIEDGELDKRVAKRYAGWNGELGQQILTGQMTLTDIAHYATQHNLAPQ
HHSGHQELLENLVNHYLFDK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcagacctatttcgatcaactcgatcgcgttcgttatgaaggcccgaaatcgactaac
ccactggctttccgtcactacaatccggatgaattagtactgggtaaacgcatggaagac
cacctgcgtttcgctgcctgctactggcacactttctgctggaatggcgcggatatgttt
ggcgtggggtccttcgatcgtccatggcagcagccgggcgaagcgctggaaatggcgaaa
cgtaaagccgaagtggcatttgagtttttccataagttgaatgtgccgtattactgcttc
catgatgtcgacgtttctccggaaggcgcttcgctgaaagagtacagcaacaacttcgcg
cagatggtggacgtactggcggaaaaacagcagcagagcggcgttaaactgctgtggggg
acggcaaactgctttaccaacccgcgttatggcgcaggggcggcgacgaaccccgatccg
gaagtctttagttgggcggcgactcaggtggtcaccgcaatgaatgcgacccacaagttg
ggcggtgaaaactacgttctgtggggcggtcgcgaaggctacgaaaccctgcttaatacc
gatctgcgccaggagcgcgagcagattggccgctttatgcaactggtggttgaacacaaa
cacaaaattggtttccagggcaccctgctgatcgagccgaagccgcaggagccgaccaag
caccaatatgattatgatgcctccacggtttacgggttcctgaaacagtttggtctggaa
aaagagattaaactgaacattgaagccaaccacgccacccttgccggccactctttccac
cacgagatcgccacggctattgcgctgggcctgttcggttcggtggacgcgaaccgcggc
gatgcgcagctgggctgggataccgaccagttcccgaacagcgtagaagagaacgccctg
gtgatgtatgagatcctcaaggcgggtggcttcaccaccggcggcctgaactttgatgct
aaagttcgtcgccagagcaccgacaaatacgatctgttctacggccatatcggcgcgatg
gacactatggcgctgtcgctgaaagtcgcggcgcgcatgattgaagacggcgagctggat
aaacgcgtggcgaaacgctacgccggctggaacggtgaattgggccagcagatcctcaca
ggccagatgaccctgaccgacatcgcgcactatgcgactcagcataacctggcgccgcag
caccacagcgggcatcaggaactgctggaaaacctggtaaaccattatctgttcgataag
taa

DBGET integrated database retrieval system