KEGG   Enterobacter aerogenes KCTC 2190: EAE_06480Help
Entry
EAE_06480         CDS       T01529                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAE_06480 (tpiA)
   01230 Biosynthesis of amino acids
    EAE_06480 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAE_06480 (tpiA)
   00051 Fructose and mannose metabolism
    EAE_06480 (tpiA)
   00562 Inositol phosphate metabolism
    EAE_06480 (tpiA)
Enzymes [BR:eae01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EAE_06480 (tpiA)
Exosome [BR:eae04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EAE_06480 (tpiA)
  Exosomal proteins of bladder cancer cells
   EAE_06480 (tpiA)
  Exosomal proteins of melanoma cells
   EAE_06480 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1342809..1343576
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVANLRTELAGVSGCAVAIAPPEMYLDLAKRAAEGSHIH
LGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGVVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKIAEQVIIQYGGSVNAGNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAEAAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gaactggttgctaacctgcgtactgaactggccggcgtaagcggctgtgcagtggcaatc
gcgccgccggaaatgtatctcgacctggctaagcgtgcggcagaaggcagccacatccac
ctgggcgcgcagaacgttgacgtgaacctgtccggcgcattcaccggtgaaacctccgcc
gaaatgctgaaagatatcggcgcgcagtacatcatcatcggccactccgaacgccgtacc
taccacaaagaatccgacgagctgatcgcgaagaaattcgctgtactgaaagagcagggg
ctgacgccggttctgtgcatcggtgaaaccgaagctgaaaacgaagcgggcaaaactgaa
gaagtgtgcgcacgtcagatcgacgcggtgctgaaaactcagggcgcagccgcttttgaa
ggcgtggttatcgcgtacgaaccagtatgggctatcggtaccggtaaatccgctacccca
gcgcaggctcaggcggtacacaaattcatccgtgaccacattgctaaagctgacgctaaa
atcgctgagcaggtcatcatccagtacggcggttccgttaacgccggcaacgccgcagag
ctgttcacccagccggacatcgacggcgcgctggttggcggcgcttccctgaaagcagac
gctttcgcggtgatcgttaaagctgcagaagcggcgaaaaaagcgtaa

DBGET integrated database retrieval system