KEGG   Enterobacter aerogenes KCTC 2190: EAE_06480Help
Entry
EAE_06480         CDS       T01529                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAE_06480 (tpiA)
   01230 Biosynthesis of amino acids
    EAE_06480 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAE_06480 (tpiA)
   00051 Fructose and mannose metabolism
    EAE_06480 (tpiA)
   00562 Inositol phosphate metabolism
    EAE_06480 (tpiA)
Enzymes [BR:eae01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EAE_06480 (tpiA)
Exosome [BR:eae04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EAE_06480 (tpiA)
  Exosomal proteins of bladder cancer cells
   EAE_06480 (tpiA)
  Exosomal proteins of melanoma cells
   EAE_06480 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
1342809..1343576
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVANLRTELAGVSGCAVAIAPPEMYLDLAKRAAEGSHIH
LGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGVVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKIAEQVIIQYGGSVNAGNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAEAAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gaactggttgctaacctgcgtactgaactggccggcgtaagcggctgtgcagtggcaatc
gcgccgccggaaatgtatctcgacctggctaagcgtgcggcagaaggcagccacatccac
ctgggcgcgcagaacgttgacgtgaacctgtccggcgcattcaccggtgaaacctccgcc
gaaatgctgaaagatatcggcgcgcagtacatcatcatcggccactccgaacgccgtacc
taccacaaagaatccgacgagctgatcgcgaagaaattcgctgtactgaaagagcagggg
ctgacgccggttctgtgcatcggtgaaaccgaagctgaaaacgaagcgggcaaaactgaa
gaagtgtgcgcacgtcagatcgacgcggtgctgaaaactcagggcgcagccgcttttgaa
ggcgtggttatcgcgtacgaaccagtatgggctatcggtaccggtaaatccgctacccca
gcgcaggctcaggcggtacacaaattcatccgtgaccacattgctaaagctgacgctaaa
atcgctgagcaggtcatcatccagtacggcggttccgttaacgccggcaacgccgcagag
ctgttcacccagccggacatcgacggcgcgctggttggcggcgcttccctgaaagcagac
gctttcgcggtgatcgttaaagctgcagaagcggcgaaaaaagcgtaa

DBGET integrated database retrieval system