KEGG   Enterobacter aerogenes KCTC 2190: EAE_06510Help
Entry
EAE_06510         CDS       T01529                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    EAE_06510
Enzymes [BR:eae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     EAE_06510
Exosome [BR:eae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EAE_06510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1348838..1350349
Genome map
AA seq 503 aa AA seqDB search
MTEKKYIVALDQGTTSSRAVVMDHDANIVSVSQREFEQIYPKPGWVEHDPMEIWASQSST
LVEVLAKADINSDEIAAIGITNQRETAIVWERETGKPIYNAIVWQCRRTADICEQLKRDG
MEEYIRKATGLVVDPYFSGTKVKWILDHVEGARERAKRGELLFGTVDTWLIWKMTQGRVH
VTDYTNASRTMLFNIHELDWDDKMLDALDIPRAMLPEVRKSSEVYGQTNIGGKGGTRIPI
SGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVTSTHGLLTTIACGPTGEVN
YALEGAVFMAGASIQWLRDEMKLINDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWDPY
ARGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLM
QFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIEREFRPGIETTER
NFRYSGWKKAVKRALAWEEHDEA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaaaaaatatatcgttgcgctcgaccagggcactaccagctcccgcgccgtc
gtgatggatcacgacgccaatatcgtcagcgtgtcacagcgtgaattcgaacaaatttat
ccgaagccaggctgggttgagcacgacccgatggagatttgggcctcgcagagctctacg
ctggtcgaagtgttggcgaaagccgatatcaactccgacgaaattgccgccatcggcatc
accaaccagcgtgaaaccgccatcgtttgggagcgtgagaccggtaagcctatttacaac
gccatcgtctggcagtgccgccgcaccgcggatatctgcgagcagctcaagcgcgacggc
atggaagagtacatccgcaaagccaccggcctggtggtggacccgtacttctccggcacc
aaagtgaagtggatccttgaccatgtcgaaggcgcccgcgagcgcgcgaagcgcggcgaa
ctgctgttcggtaccgttgatacctggcttatctggaaaatgacccaggggcgcgtgcac
gtcaccgactacactaacgcctcgcgtaccatgttgttcaacatccatgaactggactgg
gacgacaaaatgctcgacgcgctggatatcccgcgcgccatgttgccggaagtacgtaag
tcttctgaagtttacggccagaccaacatcggcggtaaaggcggcacccgtattcctatc
tccggcatcgccggcgaccagcaggcggcgctgtttggccagctgtgtgtgaaagaaggg
atggcgaaaaacacctacggtaccggctgcttcatgttaatgaacaccggtgaaaaggct
gtgacctcaacccacggcctgctgaccactatcgcctgcggcccgaccggcgaagtgaac
tacgcgctggaaggcgcggtgtttatggccggagcgtcgattcagtggctgcgtgatgaa
atgaaactcatcaacgatgctttcgattctgaatacttcgccactaaggtgaaggacacc
aacggcgtgtatgtggtgccggcctttaccggtcttggcgcgccatactgggatccgtat
gcgcgcggcgcgattttcggcctgacccgcggagtgaacgccaaccatattatccgcgcc
acgctggaatctatcgcctatcagacgcgtgacgttctggaagcgatgcaggccgactcc
ggtattcgtctgcacgccctgcgcgtggacggcggcgcggtcgccaacaacttcctgatg
cagttccagtccgatattctcggcacccgcgtggaacgcccggaagtgcgtgaagtcacg
gcgctgggcgccgcttatctggcaggtctggcggtcggcttctggcaaaatctcgacgag
ctgcaggagaaagcggtgattgaacgtgagttccgcccgggtattgaaaccaccgagcgt
aatttccgctacagcggctggaagaaagcggtgaaacgcgcgttagcgtgggaagagcac
gacgaagcgtaa

DBGET integrated database retrieval system