KEGG   Klebsiella aerogenes KCTC 2190: EAE_07860Help
Entry
EAE_07860         CDS       T01529                                 

Gene name
hemD
Definition
(RefSeq) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00860  Porphyrin and chlorophyll metabolism
eae01100  Metabolic pathways
eae01110  Biosynthesis of secondary metabolites
eae01120  Microbial metabolism in diverse environments
Module
eae_M00121  Heme biosynthesis, glutamate => heme
eae_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EAE_07860 (hemD)
Enzymes [BR:eae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     EAE_07860 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-GeneID: 10791759
NCBI-ProteinID: YP_004591775
UniProt: A0A0H3FP49
Position
complement(1649395..1650135)
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPLPQGEELVSRLRALGRVAWSFPLIEFTPGRELATLPRQLAALGADDLLFALS
QHAVEFAHARLLQESQRWPSDPAYFSIGRTTALALHTVSGKNIRYPLDREISEVLLQLPE
LQNIAGKKALILRGNGGRELLGDTLRDRGAEVTFCECYQRCAKYYDGAEEAMRWQSRGVT
TLVVTSGEMLQQLWSLIPQWYREQWLLHCSLIVVSERLALQARELGWQDIQVADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcctggtcacccgtccgctaccgcaaggtgaagagttagtcagccgcctgcgc
gcgctgggacgcgtggcctggagctttccgctgattgaattcacgccggggcgagaactg
gcaacgctcccgcgtcaactggcggcattaggcgcggacgatttgttgtttgcgctgtcg
cagcatgcggtggaattcgcccatgcccgtctgctgcaggagagccaacgctggccctcc
gacccggcctatttctcgataggccgcaccaccgcgctggccctgcatacggtcagtggt
aaaaatatccgttacccgttagatcgggaaatcagcgaagtcttgctacaattacctgaa
ttacaaaacattgcgggcaagaaagccctgattctgcgcggcaacggcgggcgggaatta
ctcggcgacacgctgcgagatcgcggcgccgaagtaacattttgtgaatgttatcaacgt
tgtgcgaagtactatgatggtgcggaagaggctatgcgctggcaatctcgtggagtcaca
acgctggtggtcaccagcggcgagatgctgcagcagctgtggtcgttaataccccagtgg
tatcgcgaacagtggctgctgcactgtagccttatcgttgtcagcgaacgtctggccctt
caggcccgggaattgggctggcaggatattcaggttgccgataacgccgacaacgatgcg
ctgctacgcgcattacaataa

DBGET integrated database retrieval system