KEGG   Enterobacter aerogenes KCTC 2190: EAE_07930Help
Entry
EAE_07930         CDS       T01529                                 

Definition
phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    EAE_07930
   00565 Ether lipid metabolism
    EAE_07930
   00590 Arachidonic acid metabolism
    EAE_07930
   00591 Linoleic acid metabolism
    EAE_07930
   00592 alpha-Linolenic acid metabolism
    EAE_07930
Enzymes [BR:eae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     EAE_07930
    3.1.1.32  phospholipase A1
     EAE_07930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1663133..1664005
Genome map
AA seq 290 aa AA seqDB search
MRISLAWLLALSALPAGVLAQDAPIEQTVHDKPAVRGSIIANLLQDHDNPFLLYPYESNY
LLYTWTSDLNKEAIRSYDWADDARKDEVKFQLSLAFPLWRGILGDNSLLGASYTQKSWWQ
LSNSKGSAPFRETNYEPQLFLGFATDYEFAGWTLRDIEVGYNHDSNGRSDPTSRSWNRLY
TRLMAQNGNWLVEVKPWYVVGSTDDNPDITKYMGYYRLKIGYQLGEAIFSAQGQYNWNTG
YGGAEVGVSYPITKHVRAYTQIYSGYGESLIDYNFNQTRVGVGVMLNDLF
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatctctttagcctggctgctggcgcttagcgcgttaccagcaggcgttctggcg
caggacgcgccgattgaacaaaccgttcatgacaaacccgcggtacggggcagtattatc
gccaacctgctgcaggatcatgataatccgttcctgctttatccttatgagagcaactat
ctgctctatacatggaccagcgatctcaataaagaggcaattcgtagttacgactgggcc
gatgacgcgcgtaaggatgaggtgaagttccagctcagcctggcgttcccgttatggcgc
ggtattctcggcgataattcgctgcttggcgcctcctatacgcaaaaatcctggtggcag
ctctctaacagtaaaggctcggcgccgtttcgcgaaaccaactacgagcctcagctcttc
cttggcttcgcgacggattatgagtttgccggctggaccttgcgcgatatcgaagtcggc
tataaccacgactctaacggccgttccgatccaacgtcacgtagctggaaccgcctgtat
actcgcctgatggcgcaaaacggtaactggctggttgaagtgaagccgtggtatgtggtc
ggcagcaccgatgataacccggatattacgaaatacatgggttactaccgcctgaagatt
ggctaccagcttggcgaggctatctttagcgctcaggggcaatataactggaataccggc
tacggcggcgcggaagtcggggtcagttatcctattaccaaacatgtgcgcgcctatact
caaatctacagcggttatggcgaatcactaatcgactataacttcaatcagacgcgcgtc
ggcgtcggcgtgatgctcaacgatctgttttaa

DBGET integrated database retrieval system