KEGG   Enterobacter aerogenes KCTC 2190: EAE_07955Help
Entry
EAE_07955         CDS       T01529                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:eae00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1667589..1668581
Genome map
AA seq 330 aa AA seqDB search
MFGQQKDWDTRENAFAAFTMGPLTDFWHQREEAEFTGVDKVPVRFVRFCAANNDRLVVIC
PGRIESYVKYAELAYDLFHSGFDVMIIDHRGQGRSGRLLSDTHRGHVVRFSDYVDDLAAL
WQQEVVPGHWRKRFILAHSMGGAIATLFLQRHRQHCDAIALCAPMFGIIMRLPDWMVRHI
LDWAEGHQRIREEYAIGTGRWRALPFSLNVLTHSRQRYRRNLRFYADDPRLRVGGPTYHW
VREGILAGEEILSGVEKDTTPTLLIQAEDEKVVDNLMHDRYCELRSAAGHPCEGDKPLVI
EGAYHEILFEKDAMRSVALNAIVDFFNRHT
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggcagcaaaaggactgggacacacgagaaaacgcgtttgcggcctttaccatg
gggccgctgacggatttctggcatcagcgggaagaagctgaatttacgggcgtcgataag
gttccggtacgctttgtgcgcttttgtgccgcaaataacgaccggctggtggtcatttgc
cccggccgcatcgaaagctacgtgaagtatgccgaactagcctacgatctcttccacagc
ggctttgacgtgatgattatcgatcatcgcggccaggggcgctccggtaggttactgtct
gatacccaccgcggtcatgttgtgcgctttagcgattatgttgacgatctggctgcgctc
tggcagcaggaagtggttcccggccactggcgtaaacgttttattctcgcccactcgatg
ggcggcgccattgccacgctgttcttgcagcgtcaccggcagcattgcgacgccattgcc
ttatgcgcgccaatgtttggcatcatcatgcgcctgccggactggatggtgcgccatatt
ctcgactgggctgagggccatcagcgtattcgtgaagagtatgccatcggtacgggccgc
tggcgggcgctgccgttttcgctcaatgtgttgactcacagtcgccaacgctatcgtcgc
aacctgcgtttttatgccgacgatccgcggttgcgcgtcggcgggccgacctatcactgg
gtgcgcgaaggtattctggccggcgaagagatattgtctggcgtcgagaaagatacgact
ccgacgttattgattcaggccgaggatgaaaaggtggtcgataacctgatgcacgaccgc
tattgtgaactccgttccgctgccgggcacccttgtgaaggcgataagccgctcgttatt
gaaggggcatatcacgagatcctttttgaaaaggacgctatgcgctcagtcgcgctaaat
gccatcgtcgattttttcaatcgacatacttaa

DBGET integrated database retrieval system