KEGG   Enterobacter aerogenes KCTC 2190: EAE_08255Help
Entry
EAE_08255         CDS       T01529                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAE_08255
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EAE_08255
   00630 Glyoxylate and dicarboxylate metabolism
    EAE_08255
Enzymes [BR:eae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     EAE_08255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1745815..1747416
Genome map
AA seq 533 aa AA seqDB search
MTHQATMTDELAFSQPYGEQEKQILTAEAVEFLTELVSRFMPERNQLLAVRVQQQQAIDE
GNLPDFISETDSIRNGDWKIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPDWHKVIDGQINLRDAVNGTISYTNEAGKIYQLQPDPAVLVCRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQSWQEAAWWSKVFSFTEDRFELPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDAERNRQVLNKVTADKELEANNG
HDGTWIAHPGLADTAMDVFNRVLGEHPNQLFVTRNDDAPITAEQLLAPCEGERTEAGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLNDGTPVTKALFR
QWLAEELMVIQEELGEHRFSHGRFDDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaccaggcgacaatgaccgatgaactggccttcagccagccttatggcgagcag
gagaagcaaattctgactgcggaagcggtggagttcctgacggaactggtgagccgcttt
atgcctgagcgtaatcaactgttggcggtacgcgtccagcaacagcaggccattgatgag
ggtaatcttcctgattttatttcggaaacggattccattcgtaatggtgactggaagatt
cgaggtattccggccgatttacaagaccgccgcgtagaaatcaccggtccggttgaacgc
aagatggtaattaacgccctgaatgctaacgtcaaagtctttatggctgatttcgaagac
tcgctggcgccggattggcacaaagtcattgatggccaaatcaacctgcgcgatgcggtc
aacggcaccatcagctacaccaacgaagcggggaaaatttatcagttgcagcccgatccg
gcggttctggtctgccgcgttcgcggcctgcatctgccggaaaaacacgttacctggcgt
ggtgaggcgattcccggcagtctgttcgattttgcgctctatttcttccacaactaccag
gctctgctggcgaaagggagcggcccctatttctatctgccgaaaacccagtcctggcaa
gaggcggcatggtggagcaaagtcttcagtttcaccgaagatcgttttgaactgccgcgc
ggcaccattaaggctactttgctgattgaaacgctgccggcagtgttccagatggatgaa
atcctgcatgcgctgcgcgaccatattgttggcctgaactgcgggcgctgggactatatc
ttcagctatatcaagacgctgaaaaatcaccccgatcgtgtcctgccggatcgccaggtg
gtgacgatggataaacctttcctgagcgcctattcacgcctgctgattaagacttgccat
aagcgcggcgccttcgcgatgggcggtatggcggcgtttatcccgagcaaagacgccgag
cgcaatcgtcaggtgctgaataaagtcaccgccgataaagagctggaggctaacaatggc
cacgatggcacctggattgcgcatccgggactggcggatacggcaatggatgtctttaac
cgcgtactgggtgaacatcctaaccagctgtttgttacccgcaatgacgacgcgccgatt
accgccgagcagttgctggctccctgcgagggtgagcgtactgaagccggcatgcgcgcc
aatatccgcgtggcggtgcaatacatcgaggcctggatctccggcaacggctgcgtaccg
atttacggcctgatggaagatgcggcgacggctgagatttcgcgtacctctatctggcag
tggatccatcatcagaaaaccctgaacgacggcacaccggttaccaaggcgctgttccgc
cagtggctggctgaagagctgatggtgattcaggaagagttgggggaacaccgcttcagc
cacggtcgctttgacgatgcggcgcggctgatggagcaaatcaccacttccgacgaactg
atcgacttcttgacgttgccaggttaccgcctgctggcgtaa

DBGET integrated database retrieval system