KEGG   Enterobacter aerogenes KCTC 2190: EAE_08260Help
Entry
EAE_08260         CDS       T01529                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAE_08260
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    EAE_08260
Enzymes [BR:eae01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     EAE_08260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1747448..1748752
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELNKEWTNPRWEGITRPYSAEEVVKLRGSVNPECTLAQLGAAKMWRLLHGE
AKKGYINSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPANSVPSV
VDRINNTFRRADQIQWAAGIEPNDPRFIDYFLPIVADAEAGFGGVLNAFELMKSMIAAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLLIARTDADAADL
ITSDCDPYDREFISGDRTSEGFYRTHAGIEQAISRGLAYAPYADLVWCETSKPDIEQARR
FAEAIHARFPGKLLAYNCSPSFNWKKNLDDKTIASFQQQLSDMGYKFQFITLAGIHSMWF
NMFDLAHAYAQGEGMRHYVEKVQQPEFAAGPEGYTFVSHQQEVGTGYFDKVTTIIQGGTS
SVTALTGSTEESQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtacccaacaaatcgaagaattaaacaaagagtggacgaacccgcgctgg
gaaggcattacccgcccatacagcgcggaagaggtggtgaagttacgcggctcggtgaac
ccggaatgcacgctggcgcagcttggcgcggcgaaaatgtggcgtctgctgcatggtgaa
gcgaaaaagggttatatcaacagccttggcgcgttaaccggcggccaggcgctgcagcag
gcgaaggcgggcattgaagccatctacttgtctggctggcaggtcgccgccgacgccaac
ctggcctccagtatgtacccggatcaatcgttgtacccggctaactcggtgccatcggtg
gttgatcggatcaataacaccttccgtcgcgccgatcagatccagtgggcggcggggatt
gagccgaacgatccgcgttttatcgactatttcctgccgatcgtcgccgatgcggaagcc
ggttttggcggcgtgctgaacgcctttgagctgatgaaatcgatgattgcggccggtgca
gcggccgtgcatttcgaagatcagctggcgtcggtgaagaagtgcggacatatgggtggc
aaggtgctggtgccgacgcaagaggcgattcagaagctggtcgccgcgcgcctggcggcg
gatgtgatgggggtgccgacgctgcttatcgcccgtaccgacgctgatgccgctgacctg
attacctcggattgcgatccttacgatcgggaatttatctccggcgatcgcaccagcgaa
ggtttttatcgcacccatgccggtatcgaacaggcaatcagccgcggcctggcctacgcc
ccttacgctgacctggtatggtgtgaaacctctaaaccggacattgaacaggcacgccgt
ttcgccgaagcgatccacgcccgcttcccgggcaagctgctggcctataactgctcgccg
tcctttaactggaagaaaaatctcgacgataaaaccatcgccagcttccagcagcagctg
tcggacatgggctataaattccagttcattaccctggcgggtattcacagcatgtggttc
aacatgttcgacctggcccacgcctacgcgcagggcgaagggatgcgtcactacgtcgaa
aaagttcagcagccggagtttgccgccgggccggaaggctacaccttcgtgtcgcatcag
caggaggtgggtaccgggtacttcgataaagtgaccaccattatccagggggggacctcg
tcggtaacggcactgaccggctcgaccgaagaatcgcagttttaa

DBGET integrated database retrieval system