KEGG   Klebsiella aerogenes KCTC 2190: EAE_08630Help
Entry
EAE_08630         CDS       T01529                                 

Definition
(RefSeq) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00010  Glycolysis / Gluconeogenesis
eae00620  Pyruvate metabolism
eae00640  Propanoate metabolism
eae00680  Methane metabolism
eae01100  Metabolic pathways
eae01110  Biosynthesis of secondary metabolites
eae01120  Microbial metabolism in diverse environments
eae01130  Biosynthesis of antibiotics
eae01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAE_08630
   00620 Pyruvate metabolism
    EAE_08630
   00640 Propanoate metabolism
    EAE_08630
  Energy metabolism
   00680 Methane metabolism
    EAE_08630
Enzymes [BR:eae01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     EAE_08630
Lipid biosynthesis proteins [BR:eae01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   EAE_08630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 10791926
NCBI-ProteinID: YP_004591929
UniProt: A0A0H3FMJ3
Position
complement(1827170..1829128)
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHPIPAEIAEHCLMNPQQYQVNYQQSITNPDAFWGEQGKILDWIKPYTQVKNTSF
APGNISIKWYEDGTLNLAANCLDRHLHERGDQTAIIWEGDDASQSKNITYRQLHRDVCRF
ANVLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAIHSVIFGGFSPEAVAGRIIDSSA
RLVITSDEGLRAGRAIPLKKNVDDALKNPHVTSIEHVVVLKRTGGKIDWQEGRDLWWSDL
IEKADDQHEAVEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVMDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPVLVDNEGTPLEGATEGNLAIADSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPTPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVDKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaatacataaacaccctattcccgcagagattgcggaacattgcctgatgaat
ccgcaacagtaccaggtgaactaccaacaatccatcaccaaccccgatgccttctggggc
gagcagggtaaaatcctcgattggatcaaaccttacacacaggtgaaaaatacctctttc
gcgccgggaaacatctccatcaaatggtatgaagatggcaccctgaacctcgcggccaac
tgtctcgaccgtcatctgcacgagcgcggcgaccagaccgctatcatctgggaaggcgac
gacgccagccagagcaaaaatatcacttatcgccagcttcatcgcgatgtttgccgtttt
gccaacgtattgctcgatctgggcattaaaaaaggcgatgtcgttgcaatctatatgccg
atggtgccggaagccgccgtggccatgctggcctgcgcgcgcatcggcgctatccattcg
gttatcttcggcggcttttcgccggaagcggttgccggacgcattatcgactccagcgct
cgcctggtgatcacctctgacgaggggttacgcgccggtcgcgccatcccgctgaagaaa
aacgtcgatgatgcgctgaaaaacccgcacgtcaccagcatcgagcacgtagtggtactc
aaacgcaccggcggcaaaatcgactggcaggaaggtcgtgacctgtggtggagcgatctg
attgaaaaagcggatgaccaacatgaagcggtggaaatgaacgccgaagacccgctgttc
atcctctatacctccggctcgaccggcaagccgaaaggcgtgctgcacactaccggcggc
tacctggtgtatgcggcgactaccttcaaatacgtctttgattatcatccgggcgatatc
tactggtgcaccgccgatgtgggctgggtcaccggtcacagctacctgctgtacggcccg
ctggcctgcggcgccaccacgctgatgtttgaaggcgtgccaaactggccgaccccggcg
cgcatgtgccaggtagtggataaacatcaggtcaatattctgtacaccgcgccgacggcg
atccgcgcgctgatggcggagggcgacaaagctatcgaaggtaccgatcgttcctcactg
cgcatcctcggctcggtcggcgagccgattaacccggaagcctgggagtggtactggaag
aagatcggcaacgaaaaatgcccggtgatggacacctggtggcagaccgaaaccggcggc
ttcatgatcaccccgctgccgggcgccaccgaactgaaggccggttccgccacgcgtccg
ttcttcggcgtccagccggtactggtggacaacgaagggacgccgctggaaggcgcgacc
gagggcaatctggcgatcgccgactcctggcctggtcaggcgcgtaccctgtttggcgat
catgaacgcttcgagcagacctatttctcgacctttaaaaatatgtattttagcggcgac
ggcgcccgtcgcgacgaagatggttactactggatcaccggtcgcgtcgatgacgtactg
aacgtctccggccaccgtctgggcaccgcggaaattgaatccgcgctggtttcacatccg
aaaatcgccgaagcggcggtggtcggtattccgcataacatcaaaggccaggccatctac
gcttacgtgacgctgaatcacggcgaagagccgacaccggagctgtatgccgaagtacgt
aactgggtacgcaaagagattggcccgctggcgacgccggatgtactgcactggaccgac
tcgttgccgaaaacccgctccggcaaaatcatgcgccgtattctgcgtaagattgccgct
ggcgataccagtaatctcggggatacctcgacgctggccgatccgggcgtagtggacaaa
ctgctcgaagagaagcaggccattgcgatgccgtcataa

DBGET integrated database retrieval system