KEGG   Enterobacter aerogenes KCTC 2190: EAE_08760Help
Entry
EAE_08760         CDS       T01529                                 

Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:eae00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:eae00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:eae00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1853713..1855065
Genome map
AA seq 450 aa AA seqDB search
MSAPKITFIGAGSTVFVKNILGDVFQRPALKSAHIALMDIDETRLEESHTVVRKLMDSVG
ANGEISCHRDRKTALRDADFVVVAFQIGGYEPCTVTDFEVCKRHGLEQTIADTLGPGGIM
RALRTIPHLWAICDDMTEVCPNATMLNYVNPMAMNTWAMYARYPHIKQVGLCHSVQGTAE
ELARDLNLDPADLRYRCAGINHMAFYLSLEKKLADGSYVSIYPDLLQAYAEGRVPKPNLH
GNPRCENIVRYEMFKKLGYFVTESSEHFAEYTPWFIKPGRDDLIARYKVPLDEYPKRCVE
QLANWHKELESYKSGERIEVKPSREYASTIMNAIWTGEPSVVYGNVRNDNLIDNLPQGCC
VEVACLVDANGIQPTKVGALPAHLAALMQTNINVQTLLTQAILNEDRDYVYYATMMDPHT
AAVLGIEEIYALVDDLIASHGDWLPAWLHR
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccccaaaaattacctttatcggcgccggttcgacggtgtttgttaaaaatatt
ctcggtgatgttttccagcgcccggcgttgaaatcggcgcatatcgcgctgatggatatc
gacgaaacccggctggaagagtcgcataccgtggtgcgaaagctgatggattccgtcggt
gcgaatggcgaaattagctgccatcgcgatcgtaaaaccgccttgcgcgacgccgatttt
gtcgtcgtcgccttccagattggcggctatgaaccctgtactgtcaccgatttcgaagtc
tgtaaacgccacggccttgagcagaccattgccgatacgctgggaccgggaggcattatg
cgcgcgctgcgcactatcccgcacctgtgggctatctgcgacgacatgaccgaggtctgc
ccaaacgccaccatgcttaactacgttaatccgatggcgatgaacacctgggcgatgtac
gcccgctacccgcatatcaagcaggtgggtctgtgtcactcggtgcaaggcacagcagaa
gagctggcgcgcgatcttaacctcgacccggcggatttacgctaccgctgcgcggggatt
aaccatatggcgttctatctgtcgctggagaaaaagctcgcggacggcagctacgtcagt
atctatcccgatttgctgcaggcctacgccgaagggcgggtgccgaagccgaacctgcac
ggcaatccccgctgcgaaaacattgtccgctatgagatgttcaaaaagctgggctacttt
gtcaccgaatcgtcggagcatttcgccgaatacacgccatggtttatcaagccgggacgc
gacgatcttatcgctcgctataaagtaccgctggatgagtaccctaaacgctgcgtcgag
cagctggccaactggcataaagagctggagagctataaaagcggcgagcggatcgaggtt
aaaccttcgcgcgagtatgccagcaccatcatgaacgctatctggaccggcgagccaagc
gtagtgtacggcaacgtgcgcaacgataatcttatcgacaacctgccgcagggctgctgc
gtggaagttgcctgcctggtggatgccaacggcatccagccgacgaaagtgggcgcgctg
ccggcgcatctggcggcgctgatgcagaccaacatcaacgtgcagacgctgctgacgcag
gcgatcctcaacgaagaccgggattacgtctattacgccacgatgatggatccgcacacc
gctgcggtgctggggatcgaagagatctacgcgctggtggacgatcttatcgccagccac
ggcgactggctgccggcctggctgcaccgctaa

DBGET integrated database retrieval system