KEGG   Klebsiella aerogenes KCTC 2190: EAE_08760Help
Entry
EAE_08760         CDS       T01529                                 

Definition
(RefSeq) alpha-galactosidase
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00052  Galactose metabolism
eae00561  Glycerolipid metabolism
eae00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    EAE_08760
  Lipid metabolism
   00561 Glycerolipid metabolism
    EAE_08760
   00600 Sphingolipid metabolism
    EAE_08760
Enzymes [BR:eae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     EAE_08760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C
Motif
Other DBs
NCBI-GeneID: 10791950
NCBI-ProteinID: YP_004591953
UniProt: A0A0H3FV44
Position
1853713..1855065
Genome map
AA seq 450 aa AA seqDB search
MSAPKITFIGAGSTVFVKNILGDVFQRPALKSAHIALMDIDETRLEESHTVVRKLMDSVG
ANGEISCHRDRKTALRDADFVVVAFQIGGYEPCTVTDFEVCKRHGLEQTIADTLGPGGIM
RALRTIPHLWAICDDMTEVCPNATMLNYVNPMAMNTWAMYARYPHIKQVGLCHSVQGTAE
ELARDLNLDPADLRYRCAGINHMAFYLSLEKKLADGSYVSIYPDLLQAYAEGRVPKPNLH
GNPRCENIVRYEMFKKLGYFVTESSEHFAEYTPWFIKPGRDDLIARYKVPLDEYPKRCVE
QLANWHKELESYKSGERIEVKPSREYASTIMNAIWTGEPSVVYGNVRNDNLIDNLPQGCC
VEVACLVDANGIQPTKVGALPAHLAALMQTNINVQTLLTQAILNEDRDYVYYATMMDPHT
AAVLGIEEIYALVDDLIASHGDWLPAWLHR
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccccaaaaattacctttatcggcgccggttcgacggtgtttgttaaaaatatt
ctcggtgatgttttccagcgcccggcgttgaaatcggcgcatatcgcgctgatggatatc
gacgaaacccggctggaagagtcgcataccgtggtgcgaaagctgatggattccgtcggt
gcgaatggcgaaattagctgccatcgcgatcgtaaaaccgccttgcgcgacgccgatttt
gtcgtcgtcgccttccagattggcggctatgaaccctgtactgtcaccgatttcgaagtc
tgtaaacgccacggccttgagcagaccattgccgatacgctgggaccgggaggcattatg
cgcgcgctgcgcactatcccgcacctgtgggctatctgcgacgacatgaccgaggtctgc
ccaaacgccaccatgcttaactacgttaatccgatggcgatgaacacctgggcgatgtac
gcccgctacccgcatatcaagcaggtgggtctgtgtcactcggtgcaaggcacagcagaa
gagctggcgcgcgatcttaacctcgacccggcggatttacgctaccgctgcgcggggatt
aaccatatggcgttctatctgtcgctggagaaaaagctcgcggacggcagctacgtcagt
atctatcccgatttgctgcaggcctacgccgaagggcgggtgccgaagccgaacctgcac
ggcaatccccgctgcgaaaacattgtccgctatgagatgttcaaaaagctgggctacttt
gtcaccgaatcgtcggagcatttcgccgaatacacgccatggtttatcaagccgggacgc
gacgatcttatcgctcgctataaagtaccgctggatgagtaccctaaacgctgcgtcgag
cagctggccaactggcataaagagctggagagctataaaagcggcgagcggatcgaggtt
aaaccttcgcgcgagtatgccagcaccatcatgaacgctatctggaccggcgagccaagc
gtagtgtacggcaacgtgcgcaacgataatcttatcgacaacctgccgcagggctgctgc
gtggaagttgcctgcctggtggatgccaacggcatccagccgacgaaagtgggcgcgctg
ccggcgcatctggcggcgctgatgcagaccaacatcaacgtgcagacgctgctgacgcag
gcgatcctcaacgaagaccgggattacgtctattacgccacgatgatggatccgcacacc
gctgcggtgctggggatcgaagagatctacgcgctggtggacgatcttatcgccagccac
ggcgactggctgccggcctggctgcaccgctaa

DBGET integrated database retrieval system