KEGG   Enterobacter aerogenes KCTC 2190: EAE_09515Help
Entry
EAE_09515         CDS       T01529                                 

Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:eae00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2008453..2009196
Genome map
AA seq 247 aa AA seqDB search
MLEQVCQLARTAGDAIMDVYDGNQPMDVSSKKDDSPVTAADIAAHKVIVSGLQALDAAIP
ILSEEDPPAWEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIENGKPTLGVVYAPVM
KVMYSAQNGKAWKEECGVRKQIQVRDARPPLVVISRSHGNDPELQEYLEQLGEHQTTSIG
SSLKFCLVAEGQAQLYPRFGPTSTWDTAAGHAVAVAAGAHVHDWQGKTLDYTPRESFLNP
GFRVSIY
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgttagaacaagtatgtcagcttgcacggaccgcgggcgatgccatcatggatgtctac
gatgggaaccagccgatggatgtgagcagcaaaaaggatgattctccggttaccgcggcg
gatatcgccgcgcataaagtcattgtcagcggcctgcaggcgctggatgcagcaatcccg
atcctctccgaagaggatccgccggcgtgggaagtgcggcagcactggcagcgctactgg
ctggtcgatccgctggacggcaccaaagagtttatcaagcgcaacggcgaattcaccgtt
aatatcgcgctgattgaaaacggcaaaccgacgctgggcgtggtgtacgcgccggtgatg
aaagtgatgtacagcgcgcaaaatggcaaggcgtggaaagaagagtgcggcgtgcgcaag
cagattcaggttcgcgatgctcgcccgccgctggtggtgattagccgctcccacggtaat
gacccggagctgcaggagtatctggagcaactgggcgagcaccagaccacctcaatcggt
tcgtcgctgaaattctgcctggtggcggaaggccaggcgcagctctatccgcgctttggg
ccgaccagcacctgggacactgccgccggtcatgcggtcgcggtagccgccggggcgcac
gttcacgactggcagggtaaaaccctcgactacacgccgcgtgaatccttcctcaatccc
ggcttccgcgtctctatttattaa

DBGET integrated database retrieval system