KEGG   Enterobacter aerogenes KCTC 2190: EAE_09710Help
Entry
EAE_09710         CDS       T01529                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:eae00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:eae00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2053690..2056083
Genome map
AA seq 797 aa AA seqDB search
MINTVRYSLLTSGILLSSMALAAPAGDLPLMPWPAHVERPQAQGALALNNQLTINVSGDD
LGEAANRWRERLARQTGWTLQPQTAPAKSPTINVIVSKKVPFLPQPDSDESYQLTVNADG
ATLKANTRFGALRGMETLLQLVQNGPDGTTIPYVAIDDAPRFPWRGLLLDSARHFMPLSA
IKRQIDGMAAAKLNVLHWHLTDDQGWRFASSRYPKLQQQASDGLFYTQAQMKDIVRYAAE
RGIRVVPEIDMPGHASAIAVAYPELMSAPGPYAMERHWGVLKPVLDPTKEATYAFAEAMV
SELAAIFPDPYLHIGGDEVDDSQWRANPAIQKFLKEKGLADSHALQAYFNRRLETLLEKH
HRQMVGWDEIYHPDLPKSILIQSWQGQDALGDVAKHGYRGILSTGFYLDQPQYTAYHYRN
EIIPQGLNGVDTITDNDSAQSWQFSMPRLKGSAVEGSFTLVKGDSGWRGFIDFKGKSRRA
VQEIEWLGDNQVTFRVDTWMGETRPVLTINDDKLAGYFLLGNTRYPIDGKRLDAVPQGIQ
PTLPDAQQQKNLLGGEAALWAENVAAPVIDIKLWPRAFAVAERLWSAEDVKDSDNMYQRL
QAMDSWSTVSVGLQQHTQQLEQFTRLANSSHTLALQILAEALEPAHYYTRQHLKFQANNY
HQFEPLNRLADALPAESDTVRSLNQWAERLISDAEDTESADALRHVFTRWQNNSGDALAL
TDNNYQLAAIKPVVQQVDKLASLGLRLTDLVARQGTLDDKEFASIQAQLDTAAKTQDELV
IAAVYPLEKLLRATKIK
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgattaacaccgtgcgttacagtctgctgaccagcggaatattactgagcagcatggcg
cttgccgccccggcgggcgatctgccgctgatgccgtggcccgcccatgtggagcgcccg
caggcgcagggggcgttggcgctaaataatcagctgacgatcaacgtcagcggtgacgat
cttggcgaggcggcgaaccgctggcgcgaacgtcttgcgcggcaaaccggctggacgctc
cagccgcagacggcgccggcaaaaagcccaaccattaacgtgatcgtcagtaaaaaagtg
cctttcctgccgcagccggatagcgacgaaagctatcagctaaccgttaacgcagacggc
gcgaccctgaaagccaatacgcgttttggcgcgctgcgcggcatggaaacgctgctacag
ctggtacaaaacggccctgacggcaccaccattccttatgtcgccattgacgatgcgccg
cgcttcccgtggcgtggactgctgctggattccgcccgtcactttatgccgctgtcggcg
atcaagcggcagattgatggtatggcggcggcgaagcttaacgtactgcactggcatctg
accgacgatcagggctggcgcttcgcctccagccgctatccgaagctgcagcagcaggcc
agcgacggcctgttttatacccaggcgcagatgaaagacattgtgcgctatgccgccgaa
cgcggtattcgcgtggtgccggaaatcgatatgccgggccacgcctcggcgatcgccgtg
gcttatccggagctgatgagcgcgccggggccttacgcgatggagcgccactggggtgtg
ctgaaaccggttctcgacccaacaaaagaggccacctacgcgtttgccgaggcgatggtc
agcgaactggcggctatcttccccgatccgtatctgcatatcggcggtgatgaagtcgat
gatagccagtggcgcgccaatccggccattcagaaattcctcaaagagaaggggctggcg
gacagccacgcgctacaggcgtacttcaaccggcgcctggagacgttactcgaaaaacat
caccggcagatggtcggctgggatgaaatctaccaccctgatttaccgaagagcattctg
attcagtcctggcaggggcaggacgcattaggcgacgtcgccaaacacggctatcgcggc
attctctccaccggtttttacctcgaccagccgcagtacaccgcctatcactatcgtaat
gagattatcccgcaggggcttaacggtgtggatacgattaccgataacgacagcgcccag
agctggcagttttcgatgccgcgcctgaagggcagcgcggttgagggcagctttacgctg
gtaaaaggcgatagcggctggcgtggatttattgattttaaagggaaatcacggcgtgcc
gtgcaggagattgaatggctcggcgacaatcaggtcacgttccgcgtcgatacctggatg
ggcgagacccgcccggtgctaaccattaacgacgacaagctcgcaggctacttcctgctt
ggcaacacccgttatcccattgacggcaagcggctggatgccgtaccgcagggcattcag
ccgacgctgcccgacgcgcagcaacagaagaatctgctcggcggcgaggcggcgctgtgg
gcggaaaacgtcgccgcgccggtcatcgatatcaagctgtggccgcgggcttttgcggtg
gcggagcggctgtggtcggccgaagacgtcaaagacagcgacaatatgtatcagcgcctg
caggcgatggacagttggtcaacggtctccgtcggcctgcagcagcacactcagcagctg
gagcagttcacccgcctggcgaacagcagccatacgctggcgttgcagatcctcgccgag
gcgctggagccggcgcattactacacccgtcaacatctcaagttccaggcgaacaattac
catcaatttgaaccgcttaaccggctggccgatgcgctgccggcggagagcgacaccgta
cgcagcctgaaccagtgggcggagcggctaatcagcgatgccgaggatactgagagcgcc
gatgcgctgcgccacgtctttacccgctggcagaacaacagcggcgatgcgctggcgctg
accgacaataactatcagctggcggcgattaaaccggtggtgcagcaggttgataagctg
gcgagcctcgggctgcgcttgaccgatctggtggcgcggcagggaacgctggacgataaa
gagttcgcctcaatccaggcgcaactggatacggcggcgaaaacccaggatgagctggtg
attgcggcggtctatccgctggagaaactgctacgggcaacgaagataaaatag

DBGET integrated database retrieval system