KEGG   Enterobacter aerogenes KCTC 2190: EAE_09760Help
Entry
EAE_09760         CDS       T01529                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    EAE_09760
   00240 Pyrimidine metabolism
    EAE_09760
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    EAE_09760
   03430 Mismatch repair
    EAE_09760
   03440 Homologous recombination
    EAE_09760
Enzymes [BR:eae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     EAE_09760
DNA replication proteins [BR:eae03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     EAE_09760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2064837..2065280)
Genome map
AA seq 147 aa AA seqDB search
MKNATFYLLDNDTIVDELSAVEQLVCEIAAERWRNGKRVLIACEDEQQAIRLDEALWTRP
PESFVPHNLAGEGPRGGAPVEIAWPQKRNSSPRDILISLRLNFADFATAFTEVIDFVPYE
DSLKQLARERYKAYRMAGFNLNTATWK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcaacgttctatcttctggacaatgacaccatcgtcgacgagctcagcgcc
gtcgagcagctggtgtgtgaaattgccgcagaacgttggcgcaacggcaaacgcgtcctg
atcgcctgtgaagatgaacagcaggctattcgccttgacgaagcgctgtggacgcggccg
ccggagagctttgtgccgcataacctggcgggcgaaggcccgagaggcggcgcgccggta
gaaattgcctggccgcaaaagcgcaacagcagcccgcgggatattcttatcagcctgcgg
ctaaactttgcagattttgccaccgctttcacagaagtgatagactttgtcccttacgaa
gattctctgaaacaactggcgcgcgaacgctataaagcgtaccgcatggctggtttcaac
ctgaacacggcaacctggaaataa

DBGET integrated database retrieval system