KEGG   Enterobacter aerogenes KCTC 2190: EAE_10540Help
Entry
EAE_10540         CDS       T01529                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:eae00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:eae00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:eae03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:eae03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:eae03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2245463..2245876
Genome map
AA seq 137 aa AA seqDB search
MTSRRDWQLQQLGITQWSLRRPGALQGEIAISLPEHIRLVMVAETPPSLTEPLISDILRA
LSIRADQVLQLTPDRVAMLPQNSRCNSWRLGCETPLSLAGAQVSTPVFDELQSSAPARIA
LWQQICAHEHDFYPQHG
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacttcccgacgagactggcaattacagcaactgggaattacccagtggtcgctgcgt
cgcccgggggcgttgcagggcgaaatcgctatctcgcttcctgaacatattcgtctggtg
atggtggcggaaaccccgccgtcgctgactgaaccgcttattagcgatattctgcgcgcg
ctctcgattcgcgccgatcaggtactgcagcttacgccggaccgggtagcgatgctgccg
caaaatagccgctgcaacagctggcgactgggctgcgagacgccgctgtcgctggcgggc
gcccaggtctcgacgcccgtttttgatgaacttcagagcagcgcgccggctcgcatcgcg
ctctggcaacaaatctgcgcacatgaacacgatttctaccctcagcacggctga

DBGET integrated database retrieval system