KEGG   Klebsiella aerogenes KCTC 2190: EAE_10540Help
Entry
EAE_10540         CDS       T01529                                 

Definition
(RefSeq) DNA polymerase III subunit psi
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00230  Purine metabolism
eae00240  Pyrimidine metabolism
eae01100  Metabolic pathways
eae03030  DNA replication
eae03430  Mismatch repair
eae03440  Homologous recombination
Module
eae_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    EAE_10540
   00240 Pyrimidine metabolism
    EAE_10540
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    EAE_10540
   03430 Mismatch repair
    EAE_10540
   03440 Homologous recombination
    EAE_10540
Enzymes [BR:eae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     EAE_10540
DNA replication proteins [BR:eae03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     EAE_10540
DNA repair and recombination proteins [BR:eae03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     EAE_10540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi CSTF_C
Motif
Other DBs
NCBI-GeneID: 10792312
NCBI-ProteinID: YP_004592303
UniProt: A0A0H3FNL8
Position
2245463..2245876
Genome map
AA seq 137 aa AA seqDB search
MTSRRDWQLQQLGITQWSLRRPGALQGEIAISLPEHIRLVMVAETPPSLTEPLISDILRA
LSIRADQVLQLTPDRVAMLPQNSRCNSWRLGCETPLSLAGAQVSTPVFDELQSSAPARIA
LWQQICAHEHDFYPQHG
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacttcccgacgagactggcaattacagcaactgggaattacccagtggtcgctgcgt
cgcccgggggcgttgcagggcgaaatcgctatctcgcttcctgaacatattcgtctggtg
atggtggcggaaaccccgccgtcgctgactgaaccgcttattagcgatattctgcgcgcg
ctctcgattcgcgccgatcaggtactgcagcttacgccggaccgggtagcgatgctgccg
caaaatagccgctgcaacagctggcgactgggctgcgagacgccgctgtcgctggcgggc
gcccaggtctcgacgcccgtttttgatgaacttcagagcagcgcgccggctcgcatcgcg
ctctggcaacaaatctgcgcacatgaacacgatttctaccctcagcacggctga

DBGET integrated database retrieval system