KEGG   Enterobacter aerogenes KCTC 2190: EAE_10585Help
Entry
EAE_10585         CDS       T01529                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:eae00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2253086..2254408
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHVLSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMSMPERVSLT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDARFREIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVSNGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLYDVTMALCVEMLISGKLAADDAEARAKL
QAVLDNGKAAEVFGRMVAAQKGPSDFVENYAKYLPTAMLSKAVYAEGAGFVSEMDTRALG
MAVVSMGGGRRQASDTIDYSVGFTDMARLGDKVDGERPLAVIHAKDESSWQEAAKAVKAA
IKLDAHAPEITPTVYRRITK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcatgtattaagcgatgaa
gaaattcgctttttcatcaacggtatccgcgataatactatctctgaaggacagatcgcc
gcgctggcgatgaccatcttcttccatgatatgtctatgccggaacgtgtctcgctgacc
atggcgatgcgggattcaggaaccgttctcgactggaaaagccttaacctcaacggcccg
atcgtcgataaacactcgaccggcggcgtgggtgacgtcacctcgctgatgctggggcca
atggttgccgcctgcggcggttacgtaccgatgatctccgggcgtggtctcggccatacc
ggcggtacgcttgataaactggaagcgatcccgggttttgatattttcccggacgacgcg
cgtttccgcgaaattattaaagatgtcggcgtggcgattatcgggcagaccagctcgctc
gcgccggctgacaaacgtttctatgccacccgcgatattaccgcgacggtggattccatc
ccgctgattaccgcgtctattctggccaagaaactggcggaaggtctggacgcgctggtg
atggacgttaaagtcggcagcggcgcctttatgccgacttatgagctttcagaagcgctt
gccgaagctatcgttggcgtctctaacggcgccggcgtgcgcacgaccgcactgttaacg
gatatgaaccaggtgctggcctccagcgcgggtaacgccgttgaagttcgcgaagcggta
cagttcctgaccggcgaataccgcaacccgcgcctgtacgacgtcaccatggcgctgtgc
gtggaaatgctgatttccggcaagctggcggcggatgacgccgaggcgcgcgcgaaattg
caggcggtgctggataacggtaaagcggcggaagtctttggccgcatggtggcggcgcag
aaggggccgagcgactttgtcgaaaactatgcgaaatacctgccgacggcaatgctgagc
aaagcggtctatgctgaaggcgccggatttgtctctgaaatggatacccgcgcgctgggg
atggcggtggtgtcgatgggcggcggtcgtcgccaggcttccgatactattgactacagc
gttggctttaccgatatggcgcgccttggcgataaagttgatggcgaacgtccgctggcg
gtgattcatgcgaaagatgaatcgagctggcaggaagcggccaaagccgtgaaagcggca
ataaaattggacgcccacgccccagaaattacaccgacggtctatcgccgtatcaccaag
tag

DBGET integrated database retrieval system