KEGG   Klebsiella aerogenes KCTC 2190: EAE_10695Help
Entry
EAE_10695         CDS       T01529                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00260  Glycine, serine and threonine metabolism
eae00750  Vitamin B6 metabolism
eae01100  Metabolic pathways
eae01110  Biosynthesis of secondary metabolites
eae01120  Microbial metabolism in diverse environments
eae01230  Biosynthesis of amino acids
Module
eae_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EAE_10695
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    EAE_10695
Enzymes [BR:eae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     EAE_10695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-GeneID: 10792343
NCBI-ProteinID: YP_004592334
UniProt: A0A0H3FW50
Position
2278662..2279942
Genome map
AA seq 426 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKQQGLFFPHDLPEFNLTEIDEMLEQDFVTRSAKILS
AFIGDEIPQNELQARVASAFAFPAPVTQVQDDVGCLELFHGPTLAFKDFGGRFMAQMLTH
IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVVSVPSGNFGDLTAGLLAKSLGLPIKRFIAATNANDTVPRFLQDGNWAPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWRLNELGYAAVDDETTKATMRELKSIGYTSEPHAAIAYRA
LRDQLQPGEYGLFLGTAHPAKFKESVEEILQETLPLPKELADRADLPLLSHNLPADFAAL
RKLMMG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataacttaaaagatcataacgaacaggtcagctttgcgcaggccgtgacg
caagggcttggcaaacaacaggggctgttctttccgcacgatttgccggaattcaatctg
accgaaatcgacgaaatgctggagcaggatttcgtgacccgcagcgcgaaaatcctgtcg
gcctttattggcgatgagatcccgcagaatgaactgcaggcccgcgtagcttcggcgttc
gccttcccggcgccggtcactcaagtacaggatgatgtcggctgcctggagctgttccac
ggcccgaccctggcgtttaaagattttggcggccgttttatggcccagatgctgacgcat
atcgcaggcgataagccggtgacgatcctgaccgcgacctccggcgacaccggcgcggcc
gtggcgcatgccttctacggcctgccgaacgtcaaagtagttatcctctatccgcgcggt
aagattagcccgctgcaggagaagctgttctgcaccctgggcggcaacatcgaaaccgtg
gcgattgacggtgatttcgacgcctgtcaggcgctggttaagcaggcgtttgacgatgaa
gagctgaaggtcgcgcttggtctcaactccgccaactctattaatatcagtcgtctgctg
gcgcagatctgctactacttcgaggcggtcgcgcagctgccgcaggaggcccgtaaccag
ctggtggtgtcggtgccaagcggcaacttcggcgatctcaccgccggcctgctggcgaaa
tcgctggggctgccgattaagcgttttattgccgctaccaacgccaacgataccgtgccg
cgcttcctgcaggatggcaactgggcgccgaaggcgacgcaggcgaccctgtctaacgcc
atggacgtcagccaaccgaacaactggccgcgcgtggaagagctgttccgccgcaaaatc
tggcgtcttaatgagctgggatacgccgcggttgatgatgaaaccaccaaagcaaccatg
cgtgaactgaaatccatcggctacacctctgaaccgcatgcggcgattgcttatcgcgcg
ctgcgcgaccaattgcaaccgggcgagtacgggttattcctcggtaccgcgcatccggcg
aaattcaaagagagcgtagaagagattctgcaggagacgctgccgctgccgaaagaactg
gctgaccgcgccgacctgccgctgctgtcgcataatctgccggctgatttcgccgcgctg
cgtaagctgatgatgggctaa

DBGET integrated database retrieval system