KEGG   Enterobacter aerogenes KCTC 2190: EAE_11010Help
Entry
EAE_11010         CDS       T01529                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:eae00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:eae00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2350777..2351256
Genome map
AA seq 159 aa AA seqDB search
MISLIAALAVDRVIGMENAMPWDLPADLAWFKRNTLNKPVVMGRLTWESIGRPLPGRKNI
VISSKPGSDDRVQWVKSVDEAIAACGDAEEIMVIGGGRVYEQFLPKAHKLYLTHIDAEVE
GDTHFPDYDPDEWESVFSEFHDADAQNSHSYCFEILERR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgattagtctgattgcggcgttagctgtagatcgcgtaattggcatggagaacgctatg
ccatgggacttgcctgccgatctcgcctggtttaaacgtaataccttaaacaagccggtg
gttatggggcgtttgacctgggaatccatcggtcgcccgttgccaggacgtaaaaatatc
gttatcagcagcaagccgggcagcgacgatcgcgtgcagtgggtgaagtctgttgatgaa
gcgattgccgcctgcggtgacgcggaagagattatggtgatcggcggtggccgcgtttac
gagcagttcctgccaaaagcgcacaaactctacctgacccatattgatgcggaagtggaa
ggggatactcatttcccggattacgatccggacgaatgggaatcggtattcagcgagttc
catgatgccgatgcgcaaaactcccatagctactgcttcgagatcctcgagcgccgttaa

DBGET integrated database retrieval system