KEGG   Enterobacter aerogenes KCTC 2190: EAE_11010Help
Entry
EAE_11010         CDS       T01529                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EAE_11010 (folA)
   00670 One carbon pool by folate
    EAE_11010 (folA)
Enzymes [BR:eae01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     EAE_11010 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2350777..2351256
Genome map
AA seq 159 aa AA seqDB search
MISLIAALAVDRVIGMENAMPWDLPADLAWFKRNTLNKPVVMGRLTWESIGRPLPGRKNI
VISSKPGSDDRVQWVKSVDEAIAACGDAEEIMVIGGGRVYEQFLPKAHKLYLTHIDAEVE
GDTHFPDYDPDEWESVFSEFHDADAQNSHSYCFEILERR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgattagtctgattgcggcgttagctgtagatcgcgtaattggcatggagaacgctatg
ccatgggacttgcctgccgatctcgcctggtttaaacgtaataccttaaacaagccggtg
gttatggggcgtttgacctgggaatccatcggtcgcccgttgccaggacgtaaaaatatc
gttatcagcagcaagccgggcagcgacgatcgcgtgcagtgggtgaagtctgttgatgaa
gcgattgccgcctgcggtgacgcggaagagattatggtgatcggcggtggccgcgtttac
gagcagttcctgccaaaagcgcacaaactctacctgacccatattgatgcggaagtggaa
ggggatactcatttcccggattacgatccggacgaatgggaatcggtattcagcgagttc
catgatgccgatgcgcaaaactcccatagctactgcttcgagatcctcgagcgccgttaa

DBGET integrated database retrieval system