KEGG   Klebsiella aerogenes KCTC 2190: EAE_11385Help
Entry
EAE_11385         CDS       T01529                                 

Gene name
aceF
Definition
(RefSeq) pyruvate dehydrogenase dihydrolipoyltransacetylase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00010  Glycolysis / Gluconeogenesis
eae00020  Citrate cycle (TCA cycle)
eae00620  Pyruvate metabolism
eae01100  Metabolic pathways
eae01110  Biosynthesis of secondary metabolites
eae01120  Microbial metabolism in diverse environments
eae01130  Biosynthesis of antibiotics
eae01200  Carbon metabolism
Module
eae_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAE_11385 (aceF)
   00020 Citrate cycle (TCA cycle)
    EAE_11385 (aceF)
   00620 Pyruvate metabolism
    EAE_11385 (aceF)
Enzymes [BR:eae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EAE_11385 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H NQRA HlyD_D23 DUF1223
Motif
Other DBs
NCBI-GeneID: 10792479
NCBI-ProteinID: YP_004592470
UniProt: A0A0H3FWE6
Position
2441135..2443027
Genome map
AA seq 630 aa AA seqDB search
MAIEIKVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKVS
VGDKTETGKLIMIFDSAEGAAAAAPAQEEKAAAPAPAAAPAASAAKEVHVPDIGGDEVEV
TEIMVKVGDTIAAEQSLITVEGDKASMEVPAPFAGTVKEIKINTGDKVSTGSLIMIFEVA
GAAPAAAPAQAAAPAAAAPAAAAGVKDVNVPDIGGDEVEVTEVMVKVGDKVAAEQSLITV
EGDKASMEVPAPFAGTVKEIKISTGDKVSTGSLIMVFEVEGAAPAAAPAQAAAPAPAAAP
APAQKAAAPAAKAEGKTEFAENEAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILREDV
QAYVKEAVKRAESAPAAAAGGGLPGMLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNW
VMIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKFTPVVFIMKAVAAALEQMPRFNSS
LSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKSITELSRELTTISKKARDGKLTA
GEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMLPISLS
FDHRVIDGADGARFITIINNTLSDIRRLVM
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagtaccggacatcggggctgatgaagttgaaatcaccgagatc
ctggtcaaagttggcgacaaagttgaagctgaacagtcgctgatcaccgtagaaggcgac
aaggcctctatggaagttccgtctccgcaggctggcgtcgtgaaagagattaaagtctcc
gtcggcgacaaaaccgagactggcaaactgatcatgattttcgattccgccgaaggtgca
gcagccgctgcacctgcgcaggaagagaaagcggctgctccggcaccggcagcagcgccg
gcggcaagcgcagcgaaagaagttcacgtaccggatatcggcggcgatgaagttgaagtc
accgagatcatggttaaagtgggcgacactattgccgctgagcaatccctgatcaccgtc
gaaggcgacaaagcttctatggaagttccggcgccgttcgcgggtaccgttaaagagatc
aaaatcaacaccggcgacaaagtgtccaccggctccctgatcatgatcttcgaagtggcg
ggcgctgcgcctgcagccgctccggcacaggctgccgctccggctgccgcggcaccagct
gcagcggctggcgtgaaagacgttaacgtaccggatatcggcggcgacgaagttgaagtt
accgaagtgatggtaaaagttggcgataaagtggctgctgagcagtcactgatcaccgtc
gaaggcgacaaagcttctatggaagttccggcgccgttcgcgggtaccgttaaagagatc
aaaatcagcaccggcgacaaagtatccaccggctctctgatcatggtcttcgaagtggaa
ggcgccgcgcctgctgctgctccggctcaggccgcggcaccggcaccggctgctgcacct
gcaccggctcagaaagctgccgcgccggctgcgaaagcagaaggtaaaaccgaattcgct
gaaaacgaagcttacgttcacgcgactccgctgattcgccgcctggcgcgcgagttcggc
gtaaacctggcgaaagtgaaagggaccggccgtaaaggtcgtatcctgcgcgaagacgtt
caggcttacgtgaaagaagcggttaaacgcgctgaatccgcaccggctgctgccgcaggc
ggcggtctgccgggcatgctgccatggccgaaagttgacttcagcaagtttggcgaaatc
gaagaagtggaactgggtcgtatccagaaaatctctggcgctaacctgagccgtaactgg
gtgatgatcccgcacgttacgcacttcgacaaaaccgatatcaccgatctggaagcgttc
cgcaagcagcagaatgccgaagctgagaagcgcaaactggacgtgaaattcaccccagtg
gtcttcatcatgaaagccgttgccgctgcgcttgagcagatgccgcgcttcaacagctcg
ctgtccgaagacggtcagcgcctgacgctgaagaaatacatcaacatcggtgtggcggtt
gatactccgaacggtctggtggttccggtctttaaagacgtgaacaagaagagcatcacc
gagctgtctcgcgagctgaccaccatctcgaagaaagcgcgcgatggcaagctgactgct
ggcgaaatgcagggcggttgcttcaccatctccagcatcggcggcctgggtactacccac
ttcgcgccgattgttaacgcgccggaagtggccatcctgggcgtgtctaagtccgcgatg
gagccggtatggaatggtaaagagttcgttccgcgtctgatgctgccgatctctctgtcc
ttcgaccaccgcgtcatcgacggtgctgatggtgcccgcttcattaccatcattaacaac
accttgagcgacattcgccgcctggtgatgtaa

DBGET integrated database retrieval system