KEGG   Klebsiella aerogenes KCTC 2190: EAE_11500Help
Entry
EAE_11500         CDS       T01529                                 

Definition
(RefSeq) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00790  Folate biosynthesis
eae01100  Metabolic pathways
Module
eae_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EAE_11500
Enzymes [BR:eae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     EAE_11500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-GeneID: 10792502
NCBI-ProteinID: YP_004592493
UniProt: A0A0H3FS14
Position
complement(2467050..2467529)
Genome map
AA seq 159 aa AA seqDB search
MTLVYIAIGSNLASPLEQVNAAIRALADIPDSRVVSVSSLYRTPPLGPQDQPDYLNAAVA
LETSLAPEALLDHTQRIELQQGRVRKAERWGPRTLDLDIMLFGDAIINSERLTVPHYDMK
NRGFMLWPLFEIAPLLHFPDGLALRTALENLGAEKPAIW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaccctggtctatatcgccattggcagtaatctcgcctcgccgctcgaacaagtgaat
gcggctatccgcgcgctggccgacattccggacagccgcgtggtgagcgtatcttcactg
taccgtacgccaccgctggggccgcaggatcagcctgactatctcaatgccgccgtcgcg
cttgaaacctcgctcgcgccagaagcgctgctcgatcacactcagcgcatcgaactgcag
caggggcgggtgcgcaaagccgaacgctgggggccgcgtacgctggacctcgacatcatg
ttgtttggcgacgcaatcattaacagcgagcgcctgacggtgccgcactacgatatgaaa
aatcgcggttttatgctctggccactgtttgaaatcgccccgctgctccacttccccgat
ggcctcgcccttcgcaccgcgctggaaaatctgggcgccgaaaagcctgccatctggtaa

DBGET integrated database retrieval system