KEGG   Enterobacter aerogenes KCTC 2190: EAE_12320Help
Entry
EAE_12320         CDS       T01529                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EAE_12320
Enzymes [BR:eae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     EAE_12320
Exosome [BR:eae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EAE_12320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2644850..2645824)
Genome map
AA seq 324 aa AA seqDB search
MTDLITRPRRLRQSASLRAMFEETTLSLNDLVLPIFVEEEIDDYKAIEAMPGVMRIPEKH
LAREIERIANAGIRSVMTFGISHHTDATGSDTWNENGLVARMTRIAKQAVPEMIVMSDTC
FCEYTSHGHCGVLCEHGVDNDATLENLGKQAVVAAAAGADFIAPSAAMDGQVQAIRRSLD
AAGFTNTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMSPMNRREAIRESLLDEAQG
ADCLMVKPAGAYLDILRDIRERTDLPLGAYQVSGEYAMIKFAAQAGAIDEEKVVLESLGA
IKRAGADLIFSYFALDLAEKKILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagatttaatcactcgcccacgccgcctgcgtcaatccgcctcgctgcgcgccatg
tttgaagagacaacactgagtttgaacgacctggtgttgccgatctttgttgaagaagaa
attgacgattacaaagccatcgaagcgatgcctggcgtcatgcgtattccggaaaaacat
ctggcgcgcgaaattgagcgcatcgccaacgccggtattcgttcagtgatgacttttggc
atctcccatcataccgacgcgaccggtagcgatacctggaacgaaaacggtctggtggcg
cggatgacccgtatcgccaaacaggcggtgccggaaatgatcgtcatgtccgatacctgc
ttctgcgaatacacctcgcacggccactgcggcgtgctgtgcgagcacggcgtcgataac
gatgcgactctggaaaatctcggtaagcaggcggtggtcgccgcggccgccggcgctgat
ttcatcgcgccctccgccgcgatggacggtcaggtgcaagcgatccgccgttcgctggat
gccgcgggctttactaataccgcgattatgtcttactcgaccaaattcgcgtcatcgttc
tacggcccgttccgtgaagccgccggtaccgcgctgaaaggcgatcgtaagacctaccag
atgagcccgatgaaccgtcgcgaagcaattcgcgagtcgctgctcgatgaagcccagggc
gcggactgcctgatggtgaaaccggccggtgcctatctggatatcctgcgtgatatccgc
gagcgcaccgacctgccgctcggcgcttatcaggtcagcggcgagtacgcgatgatcaaa
tttgccgcgcaggctggcgcaatcgacgaagagaaagtggtgctggaaagccttggcgca
attaaacgcgcgggcgcggacctgatcttcagctatttcgccctcgatctggccgagaaa
aaaatcctgcgttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system