KEGG   Enterobacter aerogenes KCTC 2190: EAE_13090Help
Entry
EAE_13090         CDS       T01529                                 

Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:eae01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2802376..2803002)
Genome map
AA seq 208 aa AA seqDB search
MMNFKYVFRWHLPFLFMVLFTCRAMAADTLLVLGDSLSAGYRMAANTAWPALLNDKWQAK
TTVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFPPQQTEQTLRTVIQD
IKAAKAQPLLMQIRLPANYGRRYNEAFSAIYPQLAKEFDIPLLPFFMEEVYLKPQWMQDD
GIHPNRDAQPFIADWMATRLAPLVNHDS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacttcaagtatgttttccgctggcatttgcctttcctgtttatggttctgttt
acctgccgcgcaatggcggcggatacgctgttagtgcttggcgatagcctgagcgccggc
tatcggatggcggcgaatactgcctggcctgctctgctcaatgataagtggcaggccaaa
acgacggtggtcaatgccagtatcagcggcgatacatcgcagcagggcctggcgcgcctg
ccggcgctactgaagcagcaccaaccgcgctgggtgctggtggaactgggcggcaacgac
gggctgcgcggtttcccgccgcagcaaacggagcagacgctacgcaccgttattcaggat
atcaaagcggcgaaggcccaaccgctactgatgcaaatacgcctgcccgccaactatggg
cgccgttataatgaagcctttagcgcgatttatccgcagctggccaaagagttcgatatt
cctctgctgcccttttttatggaggaggtttatctcaagccacaatggatgcaggacgac
ggcattcatcctaatcgcgatgcgcaaccgtttattgccgactggatggcaacccggttg
gctcccttagttaatcatgactcctga

DBGET integrated database retrieval system