KEGG   Enterobacter aerogenes KCTC 2190: EAE_13580Help
Entry
EAE_13580         CDS       T01529                                 

Definition
putative glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:eae00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2918405..2919925)
Genome map
AA seq 506 aa AA seqDB search
MQATAKEFIIALDEGTTNAKAVVLDSKGKVSVKFSQPLAIQTPREGWVEQSGEALMAASL
AVIAKAVAHVGAENVAALAISNQRETAIGWYRASGEPINAAITWQCTRSAAFCDTLRRDR
QEQRIKHATGLPIAPLFSASKMRWLLDATPDGYQLAARGEICLGTIDSWLLWNLTGGQSF
FCDYSNAARTQLLNLHRGEWDDEMLTLFGIPRAALPEIKPSSGLFGYTKGLAAIPDGIPV
MAMIGDSHAALFGHALGEAGCVKATYGTGSSVMAPVKSAQCDIAALATTVAWHDGDQLVW
GLEGNIPHTGDAVAWMADSTGLSELSAADLAHELNTLPASVDSTLGVYFVPALTGLGAPW
WDDSARGVICGLSRGVKRAHLIRAALESITYQIADVVAAMRQHAEFTLTALMVDGGPTNN
DWLMQYQADLLGCPVMRSDIPELSAIGAALLARKALTPGETADLQAFLTEHSAFQPDMAR
HQRLQQRWREWRHAVNRTLWKPDSPA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgacagccaaagagttcatcattgcgctggatgaaggcaccaccaacgcgaaa
gccgtggtgctggacagcaaaggcaaggttagcgtcaagttctcgcagcctctggcgatc
caaaccccgcgcgaaggttgggtggaacaatccggcgaggcgctgatggcggcctcgctg
gcggtgatcgccaaagcggtggctcacgtcggcgcggaaaacgttgcggcgctggctatc
agcaatcaacgcgaaaccgccatcggctggtatcgcgccagcggcgaacccattaacgcc
gccatcacctggcagtgcacccgcagcgccgcgttctgcgacacgctgcgtcgcgatcgt
caggagcagcgcattaaacacgccacgggcctgccgattgcgccgctgttttccgcctcc
aaaatgcgctggctgctggacgccactcccgatggctatcagcttgccgcacgcggcgag
atttgcctcggcactatcgacagctggctgctgtggaatttaaccggcggacaatccttc
ttctgcgattattccaacgccgcccgcacccaattgctgaatctgcaccgcggcgagtgg
gatgacgagatgctgacgctgtttggtattccgcgcgcggcgctgccggagattaaaccg
tcgagtggtctgttcggctacaccaaagggctggcggcgatccccgacggtattccggtg
atggcgatgattggcgactcccacgccgcgctcttcggccacgcgcttggcgaagctggc
tgtgtgaaagccacttacggcacaggctcctcggtgatggcgccggtaaaatcggcccag
tgcgatattgccgccctggcgaccaccgtcgcctggcacgatggcgaccagctggtgtgg
ggactggaaggcaacattcctcataccggcgatgcggtagcatggatggctgacagcacc
gggctgagcgaactctcagcagccgatttggcccacgagctgaataccctgcccgcctcc
gtcgattcgaccttaggggtctacttcgtgccggcgctgaccgggctcggcgccccctgg
tgggatgacagcgcccgcggggtgatctgcggcctcagccgcggcgtcaagcgcgcacac
ctgatccgcgcggcgctggaatccattacctatcaaattgccgacgtggtggcggcgatg
cgccagcacgctgaattcaccctgacggcgttaatggtcgacggcggcccaaccaacaac
gactggctgatgcaatatcaggccgacctgctcggctgcccggtgatgcgcagcgatatc
ccggagttgtccgccatcggcgcggcgctactcgcccgcaaagccctcactccgggtgaa
accgccgacctgcaagcctttttaaccgaacacagcgcttttcaacccgacatggcccgc
caccagcgactacagcagcgctggcgggagtggcgccatgcggtaaacagaacattatgg
aaaccggattcgccagcctga

DBGET integrated database retrieval system