KEGG   Klebsiella aerogenes KCTC 2190: EAE_14180Help
Entry
EAE_14180         CDS       T01529                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00020  Citrate cycle (TCA cycle)
eae00640  Propanoate metabolism
eae00660  C5-Branched dibasic acid metabolism
eae01100  Metabolic pathways
eae01110  Biosynthesis of secondary metabolites
eae01120  Microbial metabolism in diverse environments
eae01130  Biosynthesis of antibiotics
eae01200  Carbon metabolism
Module
eae_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eae_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EAE_14180 (sucC)
   00640 Propanoate metabolism
    EAE_14180 (sucC)
   00660 C5-Branched dibasic acid metabolism
    EAE_14180 (sucC)
Enzymes [BR:eae01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     EAE_14180 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-GeneID: 10793053
NCBI-ProteinID: YP_004593028
UniProt: A0A0H3FT18
Position
3052749..3053915
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVKSKEEIRAFAEHWLGKRLVTYQTDANGQPVNQILVEAATDIDKELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPHLIHKIAIDPLAGPMPYQGRELAFKLGLEGKQVQQFTKI
FMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNALFRQPDLREMRDQSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDNVKAVLVNIFGGIVRCDLIADGIIGAVEEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAKSLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaggcaaaacaactttttgcccgctatggcttaccggcgccg
gtgggttatgcctgtactactccgcgtgaagcagaagaagccgcttcaaaaatcggcgcg
ggtccgtgggtagtgaaatgtcaggttcacgctggtggccgcggtaaagcgggcggtgtg
aaagtagttaagagcaaagaagagattcgcgcttttgctgagcattggctgggcaaacgc
ctggtgacttaccaaacagatgctaacggccagccggtaaaccagattctggttgaagcg
gcgaccgatattgataaagagctgtatctgggcgcggttgttgaccgtagctcccgtcgc
gtggtgttcatggcgtctaccgaaggcggcgtggaaatcgaaaaagtagcggaagaaacc
ccgcacctgatccacaagatcgccatcgatccgctggcgggcccgatgccttaccagggt
cgcgaactggcgttcaaactgggtctggaaggtaaacaggttcagcagttcaccaagatc
ttcatggggctggcgaccatcttcctcgagcgcgacctggcgctgatcgaaatcaacccg
ctggttatcaccaagcagggtgacctgatctgcctcgacggtaaactgggcgctgacggc
aacgcgctgttccgccagccggatctgcgtgaaatgcgcgaccagtctcaggaagatccg
cgcgaagctcaggcggcgcagtgggaactgaactacgttgcgctcgacggcaacatcggt
tgcatggttaacggcgcaggcctggcgatgggtaccatggacatcgttaagctgcacggc
ggcgaaccggctaacttcctcgacgttggcggcggcgcgaccaaagagcgcgtgaccgaa
gcgtttaaaatcatcctctctgacgacaacgttaaagcggttctggttaacatcttcggc
ggtatcgtacgttgcgacctgatcgctgacggcatcatcggcgcggttgaagaagtgggt
gttaacgtaccggttgttgtacgtctcgaaggtaacaacgccgaactgggcgcgaaaaaa
ctggctgacagcggcctgaatattattgcagcgaaaagtctgacggacgcagcacagcag
gttgttgccgcagtggaggggaaataa

DBGET integrated database retrieval system